spacer

EBI Dbfetch

ID   AY323834; SV 1; linear; genomic DNA; STD; HUM; 871 BP.
XX
AC   AY323834;
XX
DT   15-JUL-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, exons 2 and 3 and partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-871
RX   DOI; 10.1111/j.1399-0039.2005.00414.x.
RX   PUBMED; 15982262.
RA   Chu C.C., Lee H.L., Chen Z.X., Lin M.;
RT   "A newly identified HLA-C allele: Cw*1210, and confirmation of
RT   HLA-Cw*080102";
RL   Tissue Antigens 66(1):61-63(2005).
XX
RN   [2]
RP   1-871
RA   Chu C.-C., Chen Z.-X., Lin M.;
RT   "A novel HLA-Cw allele found in Taiwan";
RL   Unpublished.
XX
RN   [3]
RP   1-871
RA   Chu C.-C., Chen Z.-X., Lin M.;
RT   ;
RL   Submitted (13-JUN-2003) to the INSDC.
RL   Medical Research Department, Mackay Memorial Hospital, Taipei, Taiwan
XX
DR   MD5; 82b513990291f3eaaa1f2a7be16206e8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..871
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>871
FT                   /gene="HLA-Cw"
FT   mRNA            join(<69..338,585..>860)
FT                   /gene="HLA-Cw"
FT                   /product="MHC class I antigen"
FT   CDS             join(<69..338,585..>860)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q7YP80"
FT                   /db_xref="IMGT/HLA:C*12:10:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YP80"
FT                   /protein_id="AAP84346.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEAGSHTLQRMFGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            69..338
FT                   /gene="HLA-Cw"
FT                   /number=2
FT   exon            585..860
FT                   /gene="HLA-Cw"
FT                   /number=3
XX
SQ   Sequence 871 BP; 149 A; 288 C; 323 G; 111 T; 0 other;
     gggcgcagga cccggggagc cgcgcaggga ggagggtcgg gcgggtctca gcccctcctc        60
     gcccccaggc tcccactcca tgaggtattt ctacaccgcc gtgtcccggc ccggccgcgg       120
     agagccccgc ttcatcgcag tgggctacgt ggacgacacg cagttcgtgc ggttcgacag       180
     cgacgccgcg agtccaagag gggagccgcg ggcgccgtgg gtggagcagg aggggccgga       240
     gtattgggac cgggagacac agaagtacaa gcgccaggca caggctgacc gagtgagcct       300
     gcggaacctg cgcggctact acaaccagag cgaggccggt gagtgacccc ggcccggggc       360
     gcaggtcacg acccctcccc atcccccacg gacggcccgg gtcgccccga gtctcccggt       420
     ctgagatcca ccccgaggct gcggaacccg cccagaccct cgaccggaga gagccccagt       480
     cacctttacc cggtttcatt ttcagtttag gccaaaatcc ccgcgggttg gtcggggctg       540
     gggcggggct cgggggacgg ggctgaccac gggggcgggg ccagggtctc acaccctcca       600
     gaggatgttt ggctgcgacc tggggccgga cgggcgcctc ctccgcgggt atgaccagtc       660
     cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgcgctcct ggaccgctgc       720
     ggacacggcg gctcagatca cccagcgcaa gtgggaggcg gcccgtgagg cggagcagtg       780
     gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg agaacgggaa       840
     ggagacgctg cagcgcgcgg gtaccagggg c                                      871
//


spacer
spacer