spacer

EBI Dbfetch

ID   AY312054; SV 1; linear; genomic DNA; STD; HUM; 370 BP.
XX
AC   AY312054;
XX
DT   01-JUL-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*0302 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-370
RX   DOI; 10.1111/j.0001-2815.2004.00196.x.
RX   PUBMED; 15140047.
RA   Balas A., Aviles M.J., Lillo R., Alonso-Nieto M., Zarapuz L.,
RA   Garcia-Villaescusa R., Garcia-Sanchez F., Vicario J.L.;
RT   "Sequencing of two new HLA class II alleles: DRB3*0218 and DQB1*030202";
RL   Tissue Antigens 63(6):614-616(2004).
XX
RN   [2]
RP   1-370
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   "Characterization of two new HLA class II alleles";
RL   Unpublished.
XX
RN   [3]
RP   1-370
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   ;
RL   Submitted (03-JUN-2003) to the INSDC.
RL   Histocompatibility, CTM, Menendez Pelayo, Madrid 28009, Spain
XX
DR   MD5; f337f942f718913bfee2fb08e9bbddd9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..370
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>370
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0302 variant"
FT   mRNA            <6..>275
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0302 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <6..>275
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0302 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q7YPW2"
FT                   /db_xref="IMGT/HLA:DQB1*03:02:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YPW2"
FT                   /protein_id="AAP78473.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR"
FT   exon            6..275
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0302 variant"
FT                   /number=2
XX
SQ   Sequence 370 BP; 72 A; 104 C; 134 G; 60 T; 0 other;
     cgcagaggat ttcgtgtacc agtttaaggg catgtgctac ttcaccaacg ggacggagcg        60
     cgtgcgtctt gtgaccagat acatctataa ccgagaggag tacgcacgct tcgacagcga       120
     cgtgggggtg tatcgggcgg tgacgccgct ggggccgcct gccgccgagt actggaacag       180
     ccagaaggaa gtcctggaga ggacccgggc ggagctggac acggtgtgca gacacaacta       240
     ccagttggag ctccgcacga ccttgcagcg gcgaggtgag cgtcgtcgcc cgtctgcgag       300
     gcccatcctt ggcaggggcc cagagtctct gcgccaggag gggcgaaggg ggcgcggcct       360
     ctggaacctt                                                              370
//


spacer
spacer