Dbfetch

ID   AY310505; SV 1; linear; genomic DNA; STD; HUM; 2006 BP.
XX
AC   AY310505;
XX
DT   01-JUL-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*0312 allele, exons 1
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2006
RA   Iglehart B.A., Scott J.K., Avergas C.U., Leffell M.S.;
RT   "Identification of a Novel HLA A*0312 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-2006
RA   Iglehart B.A., Scott J.K., Avergas C.U., Leffell M.S.;
RT   ;
RL   Submitted (30-MAY-2003) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E.Monument St., Baltimore, MD
RL   21205, USA
XX
DR   MD5; acf15cd79001d3a19c3f2d5d8ee90694.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2006
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2006
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0312"
FT   mRNA            join(<1..61,192..461,703..978,1557..1832,1935..>2006)
FT                   /gene="HLA-A"
FT                   /product="human leukocyte antigen A"
FT   CDS             join(<1..61,192..461,703..978,1557..1832,1935..>2006)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /note="human leukocyte antigen A; HLA A"
FT                   /db_xref="IMGT/HLA:A*03:12"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YPW4"
FT                   /protein_id="AAP74975.1"
FT                   /translation="APRTLLLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPRFIAV
FT                   GYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGY
FT                   YNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQIT
FT                   KRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLR
FT                   CWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHV
FT                   QHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVI"
FT   exon            <1..61
FT                   /gene="HLA-A"
FT                   /number=1
FT   exon            192..461
FT                   /gene="HLA-A"
FT                   /number=2
FT   exon            703..978
FT                   /gene="HLA-A"
FT                   /number=3
FT   exon            1557..1832
FT                   /gene="HLA-A"
FT                   /number=4
FT   exon            1935..>2006
FT                   /gene="HLA-A"
FT                   /number=5
XX
SQ   Sequence 2006 BP; 368 A; 622 C; 654 G; 362 T; 0 other;
     gcgccccgaa ccctcctcct gctactctcg ggggccctgg ccctgaccca gacctgggcg        60
     ggtgagtgcg gggtcgggag ggaaaccgcc tctgcgggga gaagcaaggg gccctcctgg       120
     cgggggcgca ggaccggggg agccgcgccg ggacgagggt cgggcaggtc tcagccactg       180
     ctcgccccca ggctcccact ccatgaggta tttctacacc tccgtgtccc ggcccggccg       240
     cggggagccc cgcttcatcg ccgtgggcta cgtggacgac acgcagttcg tgcggttcga       300
     cagcgacgcc gcgagccaga ggatggagcc gcgggcgccg tggatagagc aggaggggcc       360
     ggagtattgg gaccaggaga cacggaatgt gaaggcccag tcacagactg accgagtgga       420
     cctggggacc ctgcgcggct actacaacca gagcgaggcc ggtgagtgac cccggccggg       480
     ggcgcaggtc aggacccctc atcccccacg gacgggccag gtcgcccaca gtctccgggt       540
     ccgagatcca ccccgaagcc gcgggacccc gagacccttg ccccgggaga ggcccaggcg       600
     cctttacccg gtttcatttt cagtttaggc caaaaatccc cccgggttgg tcggggctgg       660
     gcggggctcg ggggactggg ctgaccgcgg ggtcggggcc aggttctcac accatccaga       720
     taatgtatgg ctgcgacgtg gggtcggacg ggcgcttcct ccgcgggtac cggcaggacg       780
     cctacgacgg caaggattac atcgccctga acgaggacct gcgctcttgg accgcggcgg       840
     acatggcggc tcagatcacc aagcgcaagt gggaggcggc ccatgaggcg gagcagttga       900
     gagcctacct ggatggcacg tgcgtggagt ggctccgcag atacctggag aacgggaagg       960
     agacgctgca gcgcacgggt accaggggcc acggggcgcc tccctgatcg cctgtagatc      1020
     tcccgggctg gcctcccaca aggaggggag acaattggga ccaacactag aatatcaccc      1080
     tccctctggt cctgagggag aggaatcctc ctgggttcca gatcctgtac cagagagtga      1140
     ctctgaggtt ccgccctgct ctctgacaca attaagggat aaaatctctg aaggagtgac      1200
     gggaagacga tccctcgaat actgatgagt ggttcccttt gacaccggca gcagccttgg      1260
     gcccgtgact tttcctctca ggccttgttc tctgcttcac actcaatgtg tgtgggggtc      1320
     tgagtccagc acttctgagt ccctcagcct ccactcaggt caggaccaga agtcgctgtt      1380
     cccttctcag ggaatagaag attatcccag gtgcctgtgt ccaggctggt gtctgggttc      1440
     tgtgctctct tccccatccc gggtgtcctg tccattctca agatggccac atgcgtgctg      1500
     gtggagtgtc ccatgacaga tgcaaaatgc ctgaattttc tgactcttcc cgtcagaccc      1560
     ccccaagaca catatgaccc accaccccat ctctgaccat gaggccaccc tgaggtgctg      1620
     ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg gggaggacca      1680
     gacccaggac acggagctcg tggagaccag gcctgcaggg gatggaacct tccagaagtg      1740
     ggcggctgtg gtggtgcctt ctggagagga gcagagatac acctgccatg tgcagcatga      1800
     gggtctgccc aagcccctca ccctgagatg gggtaaggag ggagatgggg gtgtcatgtc      1860
     tcttagggaa agcaggagcc tctctggaga cctttagcag ggtcagggcc cctcaccttc      1920
     ccctcttttc ccagagctgt cttcccagcc caccatcccc atcgtgggca tcattgctgg      1980
     cctggttctc cttggagctg tgatca                                           2006
//