spacer

EBI Dbfetch

ID   AY305859; SV 1; linear; genomic DNA; STD; HUM; 311 BP.
XX
AC   AY305859;
XX
DT   23-JUN-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II DR-beta-1 antigen (HLA-DRB1) gene, HLA-DRB1*1147
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-311
RX   DOI; 10.1111/j.0001-2815.2004.00217.x.
RX   PUBMED; 15191533.
RA   Li Y., Liao C., Yang X., Tang X.W., Wu J.Y., Huang Y.N., Xie X.M.;
RT   "Identification of a novel HLA-DRB1 allele (DRB1*1147)* by sequence-based
RT   typing in eight siblings";
RL   Tissue Antigens 64(1):102-105(2004).
XX
RN   [2]
RP   1-311
RA   Li Y., Yang X., Tang X., Wu J., Huang Y., Liao C.;
RT   ;
RL   Submitted (24-MAY-2003) to the INSDC.
RL   Guangzhou Cord Blood Bank, Guangzhou Maternal and Neonatal Hospital,
RL   Renminzhong Road #398, Guangzhou, Guangdong 510180, China
XX
DR   MD5; d8dc4dcd2fc7cbd041c15f233c97d9a2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..311
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="China:Anhui"
FT                   /sex="male"
FT                   /cell_type="lymphocyte"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>311
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1147"
FT   mRNA            <23..>292
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1147"
FT                   /product="MHC class II DR-beta-1 antigen"
FT   CDS             <23..>292
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1147"
FT                   /product="MHC class II DR-beta-1 antigen"
FT                   /db_xref="GOA:Q7YPZ9"
FT                   /db_xref="IMGT/HLA:DRB1*11:47"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YPZ9"
FT                   /protein_id="AAP70485.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGAVESFTVQRR"
FT   exon            23..292
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1147"
FT                   /number=2
XX
SQ   Sequence 311 BP; 61 A; 76 C; 115 G; 59 T; 0 other;
     tggatcgttc gtgtccccac agcacgtttc ttggagtact ctacgtctga gtgtcatttc        60
     ttcaatggga cggagcgggt gcggttcctg gacagatact tctataacca agaggagtcc       120
     gtgcgcttcg acagcgacgt gggggagttc cgggcggtga cggagctggg gcggcctgat       180
     gaggagtact ggaacagcca gaaggacttc ctggaagaca ggcgggccgc ggtggacacc       240
     tactgcagac acaactacgg ggctgtggag agcttcacag tgcagcggcg aggtgagcgc       300
     ggcgcggggc g                                                            311
//


spacer
spacer