spacer

EBI Dbfetch

ID   AH013242; SV 2; linear; genomic DNA; STD; HUM; 648 BP.
XX
AC   AH013242; AY303573-AY303574;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens truncated MHC class I antigen (HLA-B) gene, HLA-B*15 variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-272
RA   Smith A.G., Warnock S., McKinney S., Regen L., Peterson P., Sprague M.,
RA   Hansen J.A.;
RT   "A novel HLA-B*15 expression variant allele detected in a hematopoietic
RT   stem cell transplant recipient";
RL   Unpublished.
XX
RN   [2]
RP   373-648
RA   Smith A.G., Warnock S., McKinney S., Regen L., Peterson P., Sprague M.,
RA   Hansen J.A.;
RT   "Detection of a novel HLA-B*15 expression variant allele in a hematopoietic
RT   stem cell transplant recipient";
RL   Unpublished.
XX
RN   [3]
RP   1-648
RA   Smith A.G., Warnock S., McKinney S., Regen L., Peterson P., Sprague M.,
RA   Hansen J.A.;
RT   ;
RL   Submitted (21-MAY-2003) to the INSDC.
RL   Clinical Immunogenetics, Seattle Cancer Care Alliance, 825 Eastlake Ave.
RL   E., Seattle, WA 98109, USA
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:34559236, gi:34559237, gi:34559235.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..648
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>648
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15 variant"
FT   mRNA            join(<1..272,373..>648)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..272,373..480)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15 variant"
FT                   /product="truncated MHC class I antigen"
FT                   /note="alpha 1 domain; contains insertion in exon 2 leading
FT                   to truncated protein and lack of cell surface expression"
FT                   /protein_id="AAQ75375.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYTTRARPGLTPSRGCTAATWG
FT                   RTGASSAGMTSPPTTARITSP"
FT   exon            1..272
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15 variant"
FT                   /number=2
FT   gap             273..372
FT                   /estimated_length=unknown
FT   exon            373..648
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15 variant"
FT                   /number=3
XX
SQ   Sequence 648 BP; 111 A; 174 C; 193 G; 70 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacacaacc agagcgaggc cgnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnggtctcac accctccaga ggatgtacgg ctgcgacgtg gggccggacg       420
     ggcgcctcct ccgcgggcat gaccagtccg cctacgacgg caaggattac atcgccctga       480
     acgaggacct gagctcctgg accgcggcgg acacggcggc tcagatcacc cagcgcaagt       540
     gggaggcggc ccgtgaggcg gagcagtgga gagcctacct ggagggcctg tgcgtggagt       600
     ggctccgcag atacctggag aacgggaagg agacgctgca gcgcgcgg                    648
//


spacer
spacer