spacer

EBI Dbfetch

ID   AY299386; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY299386;
XX
DT   16-JUN-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*03new allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2004.00296.x.
RX   PUBMED; 15496209.
RA   Dubois V., Favre-Victoire I., Gebuhrer L.;
RT   "Three new DRB alleles routinely identified by sequence-based typing:
RT   DRB1*010103, DRB1*0326 and DRB3*0219";
RL   Tissue Antigens 64(5):621-623(2004).
XX
RN   [2]
RP   1-270
RA   Dubois V., Favre Victoire I., Gebuhrer L.;
RT   ;
RL   Submitted (15-MAY-2003) to the INSDC.
RL   Laboratoire HLA, EFS Rhone Alpes, 1-3 rue du Vercors, Lyon 69007, France
XX
DR   MD5; 60c1c01625039bef90b460ffbf386d85.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03new"
FT                   /product="MHC class II"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q7YQ27"
FT                   /db_xref="IMGT/HLA:DRB1*03:26"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YQ27"
FT                   /protein_id="AAP57472.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEENARFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 60 A; 65 C; 98 G; 47 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagaacgc gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaacta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer