spacer

EBI Dbfetch

ID   AY297540; SV 1; linear; genomic DNA; STD; HUM; 877 BP.
XX
AC   AY297540;
XX
DT   16-JUN-2003 (Rel. 76, Created)
DT   16-SEP-2010 (Rel. 106, Last updated, Version 5)
XX
DE   Homo sapiens isolate BMT46M-B55V MHC class I antigen (HLA-B) gene, exons 2
DE   and 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-877
RX   DOI; 10.1111/j.1744-313X.2006.00619.x.
RX   PUBMED; 16984278.
RA   Chu C.C., Chang H.L., Chen Z.S., Lee H.L., Lin M.;
RT   "A novel HLA-B allele, B*5612, identified by sequence-based typing method";
RL   Int. J. Immunogenet. 33(5):343-345(2006).
XX
RN   [2]
RP   1-877
RA   Chu C.-C., Chen Z.-X., Lin M.;
RT   "A novel HLA-B allele found in Taiwan";
RL   Unpublished.
XX
RN   [3]
RP   1-877
RA   Chu C.-C., Chen Z.-X., Lin M.;
RT   ;
RL   Submitted (14-MAY-2003) to the INSDC.
RL   Medical Research Department, Mackay Memorial Hospital, Taipei, Taiwan
XX
DR   MD5; f9a82c2970bf7fa70d048d58afe90265.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..877
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="BMT46M-B55V"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>877
FT                   /gene="HLA-B"
FT   mRNA            join(<52..321,567..>842)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(<52..321,567..>842)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q7YQ28"
FT                   /db_xref="IMGT/HLA:B*56:12"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YQ28"
FT                   /protein_id="AAP56257.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            52..321
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            567..842
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 877 BP; 153 A; 293 C; 317 G; 114 T; 0 other;
     agccgcgccg ggaggagggt ctggcgggtc tcagcccctc ctcgccccca ggctcccact        60
     ccatgaggta tttctacacc gccatgtccc ggcccggccg cggggagccc cgcttcatcg       120
     cagtgggcta cgtggacgac acgcagttcg tgaggttcga cagcgacgcc gcgagtccga       180
     gagaggagcc gcgggcgccg tggatagagc aggaggggcc ggagtattgg gaccggaaca       240
     cacagatcta caaggcccag gcacagactg accgagagag cctgcggaac ctgcgcggct       300
     actacaacca gagcgaggcc ggtgagtgac cccggcccgg ggcgcaggtc acgactcccc       360
     atcccccacg tacggcccgg gtcgccccga gtctccgggt ccgagatccg cctccctgag       420
     gccgcgggac ccgcccagac cctcgaccgg cgagagcccc aggcgcgttt acccggtttc       480
     attttcagtt gaggccaaaa tccccgcggg ttggtcgggg cggggcgggg ctcgggggac       540
     ggggctgacc gcggggccgg ggccagggtc tcacatcatc cagaggatgt acggctgcga       600
     cgtggggccg gacgggcgcc tcctccgcgg gcataaccag tacgcctacg acggcaagga       660
     ttacatcgcc ctgaacgagg acctgagctc ctggaccgcg gcggacaccg cggctcagat       720
     cacccagcgc aagtgggagg cggcccgtgt ggcggagcag ctgagagcct acctggaggg       780
     cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc tgcagcgcgc       840
     gggtaccagg ggcagtgggg agccttcccc atctcct                                877
//


spacer
spacer