spacer

EBI Dbfetch

ID   AY297539; SV 1; linear; genomic DNA; STD; HUM; 877 BP.
XX
AC   AY297539;
XX
DT   16-JUN-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens isolate R052-B40V MHC class I antigen (HLA-B) gene, exons 2
DE   and 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-877
RX   DOI; 10.1111/j.1399-0039.2006.00640.x.
RX   PUBMED; 16866894.
RA   Chu C.C., Lee H.L., Chen Z.S., Lin M.;
RT   "Identification of a novel human leukocyte antigen-B allele, B*4048, in
RT   Taiwan";
RL   Tissue Antigens 68(2):180-181(2006).
XX
RN   [2]
RP   1-877
RA   Chu C.-C., Chen Z.-X., Lin M.;
RT   "A novel HLA-B allele found in Taiwan";
RL   Unpublished.
XX
RN   [3]
RP   1-877
RA   Chu C.-C., Chen Z.-X., Lin M.;
RT   ;
RL   Submitted (13-MAY-2003) to the INSDC.
RL   Medical Research Department, Mackay Memorial Hospital, Taipei, Taiwan
XX
DR   MD5; 60d0bdae954f53934fe18166425187d0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..877
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="R052-B40V"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>877
FT                   /gene="HLA-B"
FT   mRNA            join(<52..321,567..>842)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(<52..321,567..>842)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q7YQ29"
FT                   /db_xref="IMGT/HLA:B*40:48"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YQ29"
FT                   /protein_id="AAP56256.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            52..321
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            567..842
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 877 BP; 154 A; 294 C; 311 G; 118 T; 0 other;
     agccgcgccg ggaggagggt cgggcgggtc tcagctcctc ctcgccccca ggctcccact        60
     ccatgaggta tttccacacc gccatgtccc ggcccggccg cggggagccc cgcttcatca       120
     ccgtgggcta cgtggacgac acgctgttcg tgaggttcga cagcgacgcc acgagtccga       180
     ggaaggagcc gcgggcgcca tggatagagc aggaggggcc ggagtattgg gaccgggaga       240
     cacagatctc caagaccaac acacagactt accgagagag cctgcggaac ctgcgcggct       300
     actacaacca gagcgaggcc ggtgagtgac cccggcccgg ggcgcaggtc acgactcccc       360
     atcccccacg tacggcccgg gtcgccccga gtctccgggt ccgagatccg accccctgag       420
     gccgcgggac ccgcccagac cctcgaccgg cgagagcccc aggcgcgttt acccggtttc       480
     attttcagtt gaggccaaaa tccccgcggg ttggtcgggg cggggcgggg ctcgggggac       540
     tgggctgacc gcggggccgg ggccagggtc tcacaccctc cagaggatgt acggctgcga       600
     cgtggggccg gacgggcgcc tcctccgcgg gcataaccag ttagcctacg acggcaagga       660
     ttacatcgcc ctgaacgagg acctgcgctc ctggaccgcc gcggacacgg cggctcagat       720
     ctcccagcgc aagttggagg cggcccgtgt ggcggagcag ctgagagcct acctggaggg       780
     cgagtgcgtg gagtggctcc gcagatacct ggagaacggg aaggacaagc tggagcgcgc       840
     tggtaccagg ggcagtgggg agccttcccc atctcct                                877
//


spacer
spacer