spacer

EBI Dbfetch

ID   AH012883; SV 2; linear; genomic DNA; STD; HUM; 645 BP.
XX
AC   AH012883; AY296127-AY296128;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*0801 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-645
RA   Steiner N.K., Fernandez-Vina M., Hurley C.K.;
RT   "Novel HLA-B Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-645
RA   Steiner N.K., Fernandez-Vina M., Hurley C.K.;
RT   ;
RL   Submitted (12-MAY-2003) to the INSDC.
RL   Lombardi Cancer Center, Georgetown University, 3970 Reservoir Road, NW,
RL   Washington, DC 20057, USA
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:31563498, gi:31563499, gi:31563497.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..645
FT                   /organism="Homo sapiens"
FT                   /isolate="GN00434"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>645
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801 variant"
FT                   /note="unable to distinguish if variant of HLA-B*0801 or
FT                   HLA-B*0811 because has an equal number of nucleotide
FT                   polymorphisms relative to both alleles"
FT   mRNA            join(<1..270,371..>645)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>645)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q7YQ34"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YQ34"
FT                   /protein_id="AAP55808.1"
FT                   /translation="SHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGLC
FT                   VEWLRRYLENGKDTLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>645
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0801 variant"
FT                   /number=3
XX
SQ   Sequence 645 BP; 113 A; 173 C; 190 G; 69 T; 100 other;
     gctcccactc catgaggtat ttcgacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcaggacaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggac acgctggagc gcgcg                       645
//


spacer
spacer