spacer

EBI Dbfetch

ID   AY294922; SV 1; linear; genomic DNA; STD; ROD; 892 BP.
XX
AC   AY294922;
XX
DT   31-JAN-2004 (Rel. 78, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Deomys ferrugineus growth hormone receptor (GHR) gene, exon 10 and partial
DE   cds.
XX
KW   .
XX
OS   Deomys ferrugineus (Congo forest mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Deomyinae; Deomys.
XX
RN   [1]
RP   1-892
RX   DOI; 10.1080/10635150490468701.
RX   PUBMED; 15371245.
RA   Steppan S., Adkins R., Anderson J.;
RT   "Phylogeny and divergence-date estimates of rapid radiations in muroid
RT   rodents based on multiple nuclear genes";
RL   Syst. Biol. 53(4):533-553(2004).
XX
RN   [2]
RP   1-892
RA   Steppan S.J., Adkins R.M., Anderson J.;
RT   ;
RL   Submitted (09-MAY-2003) to the INSDC.
RL   Department of Biological Science, Florida State University, Conradi 209,
RL   Tallahassee, FL 32306-1100, USA
XX
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..892
FT                   /organism="Deomys ferrugineus"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="FMNH 149427"
FT                   /db_xref="taxon:106343"
FT   gene            <1..>892
FT                   /gene="GHR"
FT   mRNA            <1..>892
FT                   /gene="GHR"
FT                   /product="growth hormone receptor"
FT   CDS             <1..>892
FT                   /codon_start=2
FT                   /gene="GHR"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:Q6WDK5"
FT                   /protein_id="AAQ62680.1"
FT                   /translation="GLHDNYKPDFYNDDSWVEFIELDIDDADEKTEGSDTDRLLSNNHE
FT                   KSISILEAKDDDSGRTSCYDPDILDTDFHTSDMCDGTSEFAQPQKLKAEADLLCLDQKN
FT                   LKNSPYDASLGSVHPCANPTVEEEKPQALVNTETESTHQLASTPVSNPASLANIDFYTQ
FT                   VSDITPAGGVVLSPGQKVKAGIIAQCDTQQPEVGAPGQENNGMKSSYFCESDAKKCISV
FT                   APHVEAMSCVKPSFNQEDIYITTESLTTAALAPDAEMPVPDYTAVHTVQSPQGLILNAT
FT                   ALLLPDKKKFLSSCGY"
FT   exon            1..892
FT                   /gene="GHR"
FT                   /number=10
XX
SQ   Sequence 892 BP; 252 A; 240 C; 199 G; 201 T; 0 other;
     aggccttcat gataactaca aacccgactt ctacaatgat gactcctggg tggagttcat        60
     tgagctagac attgatgatg cagatgaaaa gactgaaggg tcagacacag acagacttct       120
     aagcaacaac catgagaaat cgattagtat cctcgaagcg aaagatgatg attctgggcg       180
     taccagttgt tacgatcctg atattttgga cactgatttc cacaccagcg acatgtgtga       240
     tggtacctca gagtttgctc agccacagaa gttaaaagca gaagccgatc tcttgtgcct       300
     tgaccagaag aatctaaaga actcgcctta tgatgcttcc cttggctctg tgcacccctg       360
     cgctaaccca acagtggaag aagagaaacc acaggcgctt gtgaacactg aaactgagtc       420
     aacccaccaa ctggcctcta cccctgtgag caatcccgct tcactggcaa atattgactt       480
     ttacacccaa gtaagcgaca tcacaccagc aggcggtgtg gtcctttccc caggtcaaaa       540
     ggttaaggca gggataatag cccagtgcga cactcaacag ccggaggtgg gtgcgcccgg       600
     ccaagaaaat aacggcatga agagttccta cttctgtgag tcagatgcca aaaagtgcat       660
     ctctgtggcc cctcatgtcg aggccatgtc atgtgtaaaa ccaagcttta accaagagga       720
     catttacatc accacagaaa gccttaccac cgctgcgctt gctccagatg cagagatgcc       780
     tgtcccagac tacaccgccg ttcacactgt gcagtctcca cagggcctta tactcaacgc       840
     aactgctttg cttctgcctg acaaaaagaa gttcctctcc tcctgtggtt at               892
//


spacer
spacer