spacer

EBI Dbfetch

ID   AY294920; SV 1; linear; genomic DNA; STD; ROD; 907 BP.
XX
AC   AY294920;
XX
DT   31-JAN-2004 (Rel. 78, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Tatera robusta growth hormone receptor (GHR) gene, exon 10 and partial cds.
XX
KW   .
XX
OS   Gerbilliscus robustus (Fringe-tailed gerbil)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Gerbillinae; Gerbilliscus.
XX
RN   [1]
RP   1-907
RX   DOI; 10.1080/10635150490468701.
RX   PUBMED; 15371245.
RA   Steppan S., Adkins R., Anderson J.;
RT   "Phylogeny and divergence-date estimates of rapid radiations in muroid
RT   rodents based on multiple nuclear genes";
RL   Syst. Biol. 53(4):533-553(2004).
XX
RN   [2]
RP   1-907
RA   Steppan S.J., Adkins R.M., Anderson J.;
RT   ;
RL   Submitted (09-MAY-2003) to the INSDC.
RL   Department of Biological Science, Florida State University, Conradi 209,
RL   Tallahassee, FL 32306-1100, USA
XX
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..907
FT                   /organism="Gerbilliscus robustus"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="FMNH 158105"
FT                   /db_xref="taxon:410303"
FT   gene            <1..>907
FT                   /gene="GHR"
FT   mRNA            <1..>907
FT                   /gene="GHR"
FT                   /product="growth hormone receptor"
FT   CDS             <1..>907
FT                   /codon_start=2
FT                   /gene="GHR"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:Q6WDK7"
FT                   /protein_id="AAQ62678.1"
FT                   /translation="GIHDNYKPDFYNDDSWVEFIELDIDDPDEKTEGSDTDRLLSKDHE
FT                   KSVSILGAKDDDSGRTSCYDPEILDTDFHTSDMGDGTSEITQSQKLRVEANLLCLDQKN
FT                   LKNLPYDASVGSVHPCITLAVEEDKPQALVSCETESTHQLASTPMSNPASLANIDFYAQ
FT                   VSDITPAGSVVLSPGQKIKAGIAQCNTQPEAAATCRENYGMSSAYFCESDAKKCIAVAP
FT                   HMEARSCAKPDFNQEDIYITTESLTTAAQMSKTTELAPDAELPVPDYTAVHTVQSPRGL
FT                   ILNATALPLPDKKKFLSSCGY"
FT   exon            1..907
FT                   /gene="GHR"
FT                   /number=10
XX
SQ   Sequence 907 BP; 261 A; 231 C; 203 G; 212 T; 0 other;
     aggcattcat gataactaca aacctgactt ctacaatgat gactcctggg ttgagtttat        60
     tgagctagat attgatgacc cagatgaaaa gactgaaggt tcagacacag acagacttct       120
     aagcaaagac catgagaaat cggttagtat ccttggagca aaggatgatg attctggacg       180
     tactagctgt tatgaccctg aaattttgga caccgatttc cacaccagtg acatgggtga       240
     tggtacctca gagattactc agtcacagaa gttaagagtg gaagccaatc tcttgtgcct       300
     tgaccagaag aatctaaaaa acttgcctta tgatgcttct gttggctctg tgcacccctg       360
     cattacccta gcagtggaag aagacaaacc acaggcactc gtgagctgtg aaactgagtc       420
     aacccaccaa ctggcctcta caccaatgag caatcccgct tcacttgcta acattgactt       480
     ttatgcccaa gtaagcgata ttacaccagc aggcagtgta gtcctttccc cgggtcaaaa       540
     gattaaggca ggaatagccc agtgcaacac gcagccagag gcggccgcaa cctgccgaga       600
     aaattatggc atgagcagtg cctacttctg tgagtcagat gccaaaaagt gcatcgctgt       660
     ggcccctcac atggaggcca ggtcatgtgc aaaaccagac tttaaccagg aggacattta       720
     tatcaccaca gaaagcctta ccactgctgc acagatgtcc aagacaacag agcttgctcc       780
     agatgctgag ttgcctgtcc cagactacac cgcggttcac actgtgcagt ctccaagggg       840
     ccttatactc aacgcgactg ctttgccttt gcctgacaaa aagaagttcc tctcctcttg       900
     tggctat                                                                 907
//


spacer
spacer