spacer

EBI Dbfetch

ID   AY294915; SV 1; linear; genomic DNA; STD; ROD; 904 BP.
XX
AC   AY294915;
XX
DT   31-JAN-2004 (Rel. 78, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Apomys hylocoetes growth hormone receptor (GHR) gene, exon 10 and partial
DE   cds.
XX
KW   .
XX
OS   Apomys hylocoetes (Mindanao mossy forest mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Apomys.
XX
RN   [1]
RP   1-904
RX   DOI; 10.1080/10635150490468701.
RX   PUBMED; 15371245.
RA   Steppan S., Adkins R., Anderson J.;
RT   "Phylogeny and divergence-date estimates of rapid radiations in muroid
RT   rodents based on multiple nuclear genes";
RL   Syst. Biol. 53(4):533-553(2004).
XX
RN   [2]
RP   1-904
RA   Steppan S.J., Adkins R.M., Anderson J.;
RT   ;
RL   Submitted (09-MAY-2003) to the INSDC.
RL   Department of Biological Science, Florida State University, Conradi 209,
RL   Tallahassee, FL 32306-1100, USA
XX
DR   MD5; 8465b95e377aea674346949462d75630.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..904
FT                   /organism="Apomys hylocoetes"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="FMNH 147871"
FT                   /db_xref="taxon:238004"
FT   gene            <1..>904
FT                   /gene="GHR"
FT   mRNA            <1..>904
FT                   /gene="GHR"
FT                   /product="growth hormone receptor"
FT   CDS             <1..>904
FT                   /codon_start=2
FT                   /gene="GHR"
FT                   /product="growth hormone receptor"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="UniProtKB/TrEMBL:Q6WDL2"
FT                   /protein_id="AAQ62673.1"
FT                   /translation="GIHDNYKSDFYNDDSWVEFIELDIDDPDEKTEGSDTDRLLSDDHE
FT                   KSAGILGAKDDDSGRTSCYDPDILDTDFHTSDMCDGTSEFAQPEMLKSEADLLCLDQKN
FT                   LKNSPYDASLGSLHPSITLTVEDKPQPLLGSETESTHQLASIRMSNPASLANIDFYAQV
FT                   SDITPAGGVVLSPGQKIKAGIAQGNTQLEVATSCQENYSMNSAYFCESDAKKCISVAPR
FT                   MEATSCVKPSFNQEDVYITTESLTTTARMSKTAETAPDAEMPVPDYTTVHTVQSPRGLI
FT                   LNATALPLPDKKKFLSSCGY"
FT   exon            1..904
FT                   /gene="GHR"
FT                   /number=10
XX
SQ   Sequence 904 BP; 250 A; 237 C; 205 G; 212 T; 0 other;
     aggcattcat gataactaca aatccgactt ctataatgat gactcctggg ttgagttcat        60
     tgagctagat attgatgacc cggatgagaa gactgaaggg tcagacacag acagacttct       120
     aagtgatgac catgagaaat cagctggtat ccttggagca aaggatgatg attctggacg       180
     gaccagctgt tatgaccctg acattttgga tactgatttc cacaccagtg acatgtgtga       240
     tggtacctcg gaatttgctc agccagagat gttaaaatcg gaagctgatc tcttgtgcct       300
     tgaccagaag aatctgaaga actcgcctta tgatgcttcc cttggctctc tgcacccctc       360
     cattaccctg acagtggaag acaagccaca gccacttctg ggcagtgaaa ctgagtcaac       420
     ccaccaactc gcctctatac ggatgagcaa tcctgcatca ctggcaaaca ttgactttta       480
     tgcccaagta agtgacatta caccagcagg tggtgtagtc ctttccccag gccaaaagat       540
     taaggcaggg atagcccagg gcaacaccca gctggaggtg gccacgtcct gccaagaaaa       600
     ttacagcatg aacagtgcct acttctgtga gtcagatgcc aaaaagtgca tctctgtggc       660
     ccctcgcatg gaggccacgt catgtgtaaa accaagcttt aaccaagagg acgtttacat       720
     caccacagaa agccttacca ctactgcccg gatgtccaag acagcagaga ctgctcctga       780
     tgctgagatg cctgtcccag actacaccac ggttcacacc gtgcagtctc caaggggcct       840
     tatactcaac gcaactgctt tgcctttgcc tgacaaaaag aagtttctct cctcatgtgg       900
     ctat                                                                    904
//


spacer
spacer