Dbfetch

ID   AY291205; SV 1; linear; genomic DNA; STD; HUM; 302 BP.
XX
AC   AY291205;
XX
DT   01-JUN-2003 (Rel. 76, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB3) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-302
RX   DOI; 10.1111/j.0001-2815.2004.00196.x.
RX   PUBMED; 15140047.
RA   Balas A., Aviles M.J., Lillo R., Alonso-Nieto M., Zarapuz L.,
RA   Garcia-Villaescusa R., Garcia-Sanchez F., Vicario J.L.;
RT   "Sequencing of two new HLA class II alleles: DRB3*0218 and DQB1*030202";
RL   Tissue Antigens 63(6):614-616(2004).
XX
RN   [2]
RP   1-302
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   "Sequencing of two new HLA class II alleles";
RL   Unpublished.
XX
RN   [3]
RP   1-302
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   ;
RL   Submitted (05-MAY-2003) to the INSDC.
RL   Histocompatibility, Regional Transfusion Center of Madrid, Menendez Pelayo,
RL   Madrid 28009, Spain
XX
DR   MD5; 44b3f4ef9673beb0038aa878d04949a7.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..302
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>302
FT                   /gene="HLA-DRB3"
FT   mRNA            <32..>302
FT                   /gene="HLA-DRB3"
FT                   /product="MHC class II antigen"
FT   CDS             <32..>302
FT                   /codon_start=3
FT                   /gene="HLA-DRB3"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*02:18"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="AAP43643.1"
FT                   /translation="RFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAV
FT                   RELGRPDEEYWNSQKDLLEQKRGQVDNYCRHNYGVGESFTVQRRV"
XX
SQ   Sequence 302 BP; 66 A; 69 C; 110 G; 57 T; 0 other;
     tgtgtgaccg gagcattacg tgtccccaca gcacgtttct tggagctgct taagtctgag        60
     tgtcatttct tcaatgggac ggagcgggtg cggttcctgg agagacactt ccataaccag       120
     gaggagtacg cgcgcttcga cagcgacgtg ggggagtacc gggcggtgag ggagctgggg       180
     cggcctgatg aggagtactg gaacagccag aaggacctcc tggagcagaa gcggggccag       240
     gtggacaatt actgcagaca caactacggg gttggtgaga gcttcacagt gcagcggcga       300
     gt                                                                      302
//