Dbfetch

ID   AY271987; SV 1; linear; genomic DNA; STD; HUM; 271 BP.
XX
AC   AY271987;
XX
DT   05-MAY-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*01new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-271
RX   DOI; 10.1111/j.1399-0039.2004.00296.x.
RX   PUBMED; 15496209.
RA   Dubois V., Favre-Victoire I., Gebuhrer L.;
RT   "Three new DRB alleles routinely identified by sequence-based typing:
RT   DRB1*010103, DRB1*0326 and DRB3*0219";
RL   Tissue Antigens 64(5):621-623(2004).
XX
RN   [2]
RP   1-271
RA   Dubois V., Favre Victoire I., Gebuhrer L.;
RT   ;
RL   Submitted (10-APR-2003) to the INSDC.
RL   HLA Laboratory, EFS Rhone Alpes, 1-3 rue du Vercors, LYON 69007, France
XX
DR   MD5; 021ccedfeb58f7925818fa04d3bf582d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..271
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>271
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*01new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*01new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*01new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q860I8"
FT                   /db_xref="IMGT/HLA:DRB1*01:01:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q860I8"
FT                   /protein_id="AAP23231.1"
FT                   /translation="RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*01new"
FT                   /number=2
XX
SQ   Sequence 271 BP; 58 A; 61 C; 100 G; 52 T; 0 other;
     cacgtttctt gtggcagctt aagtttgaat gtcatttctt caatgggacg gagcgggtgc        60
     ggttgctgga aagatgcatc tataaccaag aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctctt ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag g                                      271
//