Dbfetch

ID   AY271986; SV 1; linear; genomic DNA; STD; HUM; 271 BP.
XX
AC   AY271986;
XX
DT   05-MAY-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB3) gene, HLA-DRB3*02new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-271
RX   DOI; 10.1111/j.1399-0039.2004.00296.x.
RX   PUBMED; 15496209.
RA   Dubois V., Favre-Victoire I., Gebuhrer L.;
RT   "Three new DRB alleles routinely identified by sequence-based typing:
RT   DRB1*010103, DRB1*0326 and DRB3*0219";
RL   Tissue Antigens 64(5):621-623(2004).
XX
RN   [2]
RP   1-271
RA   Dubois V., Favre Victoire I., Gebuhrer L.;
RT   ;
RL   Submitted (07-APR-2003) to the INSDC.
RL   Histocompatibility Laboratory, EFS Rhone Alpes, 1 et 3 rue du Vercors, Lyon
RL   69007, France
XX
DR   MD5; 6054b6e12b77477a6b2ada88bddf5792.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..271
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>271
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*02:19"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="AAP23230.1"
FT                   /translation="RFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAV
FT                   RELGRPDAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*02new"
FT                   /number=2
XX
SQ   Sequence 271 BP; 57 A; 63 C; 102 G; 49 T; 0 other;
     cacgtttctt ggagctgctt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagacacttc cataaccagg aggagtacgc gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgagg gagctggggc ggcctgatgc cgagtcctgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag g                                      271
//