spacer

EBI Dbfetch

ID   AY271378; SV 1; linear; genomic DNA; STD; MUS; 5984 BP.
XX
AC   AY271378;
XX
DT   13-MAY-2003 (Rel. 75, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Mus musculus growth hormone receptor gene, exons 9 and 10 and partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5984
RX   DOI; 10.1128/MCB.25.1.66-77.2005.
RX   PUBMED; 15601831.
RA   Rowland J.E., Lichanska A.M., Kerr L.M., White M., d'Aniello E.M.,
RA   Maher S.L., Brown R., Teasdale R.D., Noakes P.G., Waters M.J.;
RT   "In vivo analysis of growth hormone receptor signaling domains and their
RT   associated transcripts";
RL   Mol. Cell. Biol. 25(1):66-77(2005).
XX
RN   [2]
RP   1-5984
RA   Rowland J.E., Waters M.J.;
RT   "Mouse growth hormone receptor cytoplasmic exons 9 and 10 genomic clone
RT   with flanking intronic sequence";
RL   Unpublished.
XX
RN   [3]
RP   1-5984
RA   Rowland J.E., Waters M.J.;
RT   ;
RL   Submitted (07-APR-2003) to the INSDC.
RL   Department of Physiology and Pharmacology, University of Queensland, Room
RL   421 Macgregor Building, St Lucia, Queensland 4072, Australia
XX
DR   MD5; a126667e6f7df1e42b4fe8512692c6e8.
DR   Ensembl-Gn; ENSMUSG00000055737; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110697; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110698; mus_musculus.
DR   EuropePMC; PMC2490707; 18616808.
DR   EuropePMC; PMC538772; 15601831.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5984
FT                   /organism="Mus musculus"
FT                   /chromosome="15"
FT                   /strain="129/SvJ"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(<1481..1550,1817..4765)
FT                   /product="growth hormone receptor"
FT   CDS             join(<1481..1550,1817..2797)
FT                   /codon_start=2
FT                   /product="growth hormone receptor"
FT                   /note="cytoplasmic domain"
FT                   /db_xref="GOA:P16882"
FT                   /db_xref="InterPro:IPR003528"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015152"
FT                   /db_xref="InterPro:IPR025871"
FT                   /db_xref="MGI:MGI:95708"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16882"
FT                   /protein_id="AAP33018.1"
FT                   /translation="IKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILGIHDNYKPDFY
FT                   NDDSWVEFIELDIDEADVDEKTEGSDTDRLLSNDHEKSAGILGAKDDDSGRTSCYDPDI
FT                   LDTDFHTSDMCDGTLKFAQSQKLNMEADLLCLDQKNLKNLPYDASLGSLHPSITQTVEE
FT                   NKPQPLLSSETEATHQLASTPMSNPTSLANIDFYAQVSDITPAGGVVLSPGQKIKAGIA
FT                   QGNTQREVATPCQENYSMNSAYFCESDAKKCIAVAPRMEATSCIKPSFNQEDIYITTES
FT                   LTTTAQMSETADIAPDAEMSVPDYTTVHTVQSPRGLILNATALPLPDKKNFPSSCGYVS
FT                   TDQLNKIMQ"
FT   exon            1481..1550
FT                   /number=9
FT   exon            1817..4765
FT                   /number=10
FT   3'UTR           2798..4765
FT   polyA_signal    4761..4765
XX
SQ   Sequence 5984 BP; 1853 A; 1078 C; 1213 G; 1840 T; 0 other;
     agccattggg gaatctttgt ttcatatagt tcaagttact ttgtattttt atacttgaag        60
     gatgcattta tacatccata agcaagcaat agagtggcat agcatagttc agacagctgg       120
     ctttggagca atcactctgg gcctgaaggc cagccccacc aagggtcttg tataattgga       180
     gagcacagat aatatcatct ccctttcctg gttgttgtaa ggatttgatg aaatgtttaa       240
     tgcaagagcc gatcatcttg atctataaat aatcatgtgg tgaggtttta gggaccatat       300
     ctgtatcaca actgttccaa tgacgtatag aagcattcag agataattgt gttgggttta       360
     aggcataaac actggttagc tagtaacaga aagatggttt atgtaaattt attcaagaaa       420
     tgcttatgga acaacttcca tgtgctaagt aatataattc caacaagaga caaatctgta       480
     gaataaacat tgaaattaac tacagtcaaa aacaattatt tcagggctga aagcagtagt       540
     tcagcaagtg agagtgtata gcgctcttgt agaggagtca agttcaattc ccagcaccta       600
     tatggggtgg ctcacatctg ctgtaaccct agctcgtctg ccctccctag gtacctactc       660
     attcatggga tataatcaca gaaggacaca taaaataaaa ataaaatgat aaatcttgag       720
     ggcggttaca tggaagaggc tttatttaga gagggcaact gggagtggct ataggaaaga       780
     aaggagataa ttcaatttca gttaaaaata ttagtaatag attttttaaa gaaaaaataa       840
     tttcaatatt tgaaagagaa aatgtcaata catcttggta ttatgcatac aattctaccc       900
     ttattagaga tgattcaggt tagtctgtcc tattttaagt aatacaggca ctatcatgtt       960
     ggctagaagt tatcatcaat gctttttggt tactatggac tgtgtagtgc ttagcccagt      1020
     gtagtgctta gcccaaccca tttttttcaa gtttgaaaat aattttggtt ccattttatt      1080
     gattgtcttg ttttctattt ggtgttacat gctttaaaag tatcttattt gtatcttatt      1140
     tataagttac atgaaagctg gctttagaca gaattagact cctcactgcc aagtactaaa      1200
     attgaccact catcaatagc actaaaaaaa aaaaaagagt taaaccatga cttagctaaa      1260
     tgatcttaaa cgaaggcctt tgggtgatgt ttttctcctg aaacttttgc cacctacttc      1320
     ctgcttagaa ctctccctct cttttgaata ttctgcttat acaagatata agaatgccta      1380
     gaataagtga tagtactggc aatatttcat tctacctttt tgagataatt tttaagatgt      1440
     aaaataaaga tgtagaaata acactttatt tgtttccaag gattaagatg ctgattttac      1500
     ccccagtccc agttccaaag attaaaggga ttgatccaga tcttctcaag gtaactaagt      1560
     ctacattgtg gatcattcaa ttaagtagta cctaaagaat actatctatc ttctgttggg      1620
     aggggtggtg gtggttggtt ggttggttgg gttttgttgt tgactttggt ttttttgggt      1680
     tttggagtgt tttgattttt ttgtgtttgg ttagttggtt tggtttagtt tgaaatcaca      1740
     atgcatccta tctaaagtta tataatggtt ttttgagttg cttttcatag atctccactt      1800
     tctctctgcc tcctaggaag ggaagttgga ggaggtgaac accatcttag gcattcatga      1860
     taactacaaa cccgacttct acaatgatga ttcctgggtc gagttcattg agctagatat      1920
     tgatgaagca gatgtggatg agaagactga agggtctgac acagacagac ttctaagcaa      1980
     tgatcatgag aaatcagctg gtatccttgg agcaaaggat gatgattctg ggcgtaccag      2040
     ctgttacgac cctgacattt tggatactga tttccatacc agtgacatgt gtgatggtac      2100
     cttgaagttt gctcagtcac agaagttaaa tatggaagct gatctcttgt gccttgatca      2160
     gaagaatctg aagaacttgc cttatgatgc ttcccttggc tctctgcatc cctccattac      2220
     ccagacagta gaagaaaaca agccacagcc acttttgagc agcgaaactg aggcaaccca      2280
     ccaactcgcc tctacaccga tgagtaatcc cacatcactg gcaaacattg acttttatgc      2340
     ccaagtaagc gacattacac cagcaggtgg tgtagtcctt tccccaggcc aaaagattaa      2400
     ggcagggata gcccaaggca atacccagcg ggaggtggcc acgccctgcc aagaaaatta      2460
     cagcatgaac agtgcctact tttgtgagtc agatgccaaa aaatgcatcg ctgtggcccc      2520
     tcgcatggaa gccacgtctt gtataaaacc aagctttaac caagaggaca tttacatcac      2580
     cacagaaagc cttaccacta ctgcccagat gtctgagaca gcagatattg ctccagatgc      2640
     tgagatgtct gtcccagact acaccacggt tcacaccgtg cagtctccaa ggggccttat      2700
     actcaacgca actgctttgc ctttgcctga caaaaagaat tttccctcct cgtgtggtta      2760
     tgtgagcaca gaccaactga acaaaatcat gcagtagcct ttcctatctt taatggcaag      2820
     ggaaaggctg ggcacaaacg cttaaaccaa aactatgttt taaatctgtg ttgggagagc      2880
     atgagagtgg atatggattc taaaatactt tttctggaaa tgtcaaaata tcataaagtg      2940
     gaaaatcaag aattcgtaat cagataaatg ctcccattgt gaattataaa tattttaatg      3000
     aattgtcttt aagactgtat agtggcagtg attgtctgta ctgtgggtct taattttgtg      3060
     atactaagca ttaaatagct acgtttttta tgtatgtaga tcatgctttt tgaaaaagca      3120
     aaacaatcag gtggcttttg cagttcagga aattgaatgc agattatagc acaggctgat      3180
     tttttttttc ttttttaaat aactgggaac taaaactcta ggtgagaagg taaaactagt      3240
     ttggatatgc aaaacattta ttttgacatg aaattgataa agatattttt aataatttac      3300
     actttaagca tgagtacttt ataatatgct acacacatat tgtagttcag aacaatccat      3360
     ctaaggatgt agcagctaca gtgtaaagag ggtttcatgt tttggtcaat gaacgtaaag      3420
     aaaaccaaac aagttagatt tttacaaagc ccttttataa cttccaaaac ttcttaactc      3480
     taaaaatgtc taataacctg cattattaga aaaaaacatt ttaaatttgt aaacgaatat      3540
     ttttttaatt ttgaaaactt tatttttttt taatgttgaa tcaacgtatc atacaccaaa      3600
     cagtaaacag aaattataat aatggaagaa gtgctttctt cgacaaattt ccattcaagc      3660
     cacacagcta catgtaagag aagtagaagt gatgtggtgt gattggctag gatgcagaag      3720
     agcttcagga atacaagaag tgagagccca aggattggga ggagggggct ctcacatctc      3780
     cacagtgcag tctgtcaaac ccagcttggt ttttatagta ttctaagaat tattgtgtac      3840
     aaggaaaagt ctcacatgta tgaaatccag tatccagatg gggtaaagtt agcagataat      3900
     aggataggaa attaaagacc tagatctttt ttcacagaca gacacaaatt tttaattcag      3960
     ggagaaggga cagaataaat gacttcccac tcacaaagca caactcagaa gtaattaaac      4020
     aggtaacaga aaccttgcca tcaaaccttt gataagatgt attttaagta gtaagcagta      4080
     tttcaatgct tcttacttac cctcccagga caaccgatct caaataaggg agataaggta      4140
     gataaaaatc actttttgat tctgtaataa cataaacata gttctttggg ttagcacccc      4200
     cccaaaaaaa aatttatggg agaaagagga ctctcagctg actgaagaat acatctcatt      4260
     taaatatttt ttagatgcct gaaactttaa aattaccttt aagttttaat ggtatttacc      4320
     attttgccaa gacctttgtg gggaaacaag cttaatgttt agtgattttg aaatctcttt      4380
     catgcaggag agacagtgaa aatctagcct tgggtgttta aggttcgcct tgttactttg      4440
     taatagattt taataagttt ttctgctact ttgctgctat ggtttctcca atggctacat      4500
     gatttagttc atatgaagta tcatcaactt agaatctatt cagcttaaag atgtgtgttt      4560
     tgatgaacta tcttaccatt tcaccatagg ctgaccacgt ttctatagcc aaaaatagct      4620
     aaatacctca atcagttcca gaatgtcatt ttttggtact ttgctggcca cacaagccgt      4680
     tattcaccgt ttaactagtt gtgttctgca gtctatattt aactttcttt atgtctgtgg      4740
     atttttccct tcaaagttca ataaatttat tttcttggat ttctgatctt atgtttctaa      4800
     tagccttgaa gcacaattac ctagacaatg tactgagact aactgtaaag gacgtagatg      4860
     agttcattta aatgcatcag tgaatagtgg atcgtggatc acaaagcggc agaggagcag      4920
     ggtgtggtta agatagtctt tttcttttat ggactctgcc ttctctttag gataacactc      4980
     atgtggacag agacttacag atgctttgaa cacatcctaa aagttaaatg gtgtgtccaa      5040
     gttgatgggg aattgtggga aatggaaaga ggagcgttgt ctctaaacta catttctagc      5100
     ttgagtgtgt tatctgccat tgggaagagt ggttctccct gggcttatgt attgacagag      5160
     ttcttcattc tgatgactcg tcatcataag agactgacaa tgagtctcta tactagttgc      5220
     ttttctaata attgcctgaa taagcaactt agggacaaga ggtttgtcat agttcccagt      5280
     ttagagggtg ggaaaggcag ggcacctgga gtggcctggc ttgtaacagt gggaacttgc      5340
     aacatgactt gtccacatct tggaggataa ggaaacagaa agctccagct agaactaaag      5400
     gcaaatatga ctttcagttc ccacccccag ctacttggct ttgtcagata tatccctaaa      5460
     cccaaaggtt ccacaactcc taaaacagag ccatcagctt gacaccaggt cttcaaacac      5520
     gggagcctct gaaagacatt ttctattcaa gccatatgta agtttcttcc tcctgggagg      5580
     aaggttggtt aggcaggttg tgtggctcag ctcgagatgg agaggcttag attcttactt      5640
     caggtttcaa gtggtgaatt acatgctctc aggcatgcat taaggcctag gaggtagaag      5700
     gctgacattg gaattaccca gccactggac agctgtttac tgtttcagcc agtttcccaa      5760
     gctgccaaga ctgtagagaa tacttggtga ctacattcta tttaaaaaaa aaaaaaaaca      5820
     aacaaaaaag ctgagcagtg gttgtgcacg ccttcaatcc cagcacttgg gaaacagagg      5880
     caggtggatt tctgagttca aggccagcct agtctacaga gtgagttaca ggacagccag      5940
     ggctacagag aaaccctgtc tacttcaagc acctgatatc gatt                       5984
//


spacer
spacer