spacer

EBI Dbfetch

ID   AY259128; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY259128;
XX
DT   01-MAY-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens clone DR13JJJ MHC class II antigen (HLA-DRB1) gene, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Chen D.-F., Dong L., Janzen M., Rabson A., Fraser P.;
RT   "Novel HLA-DRB1*13 Alleles Detected by PCR-SSOP and Confirmed by Single
RT   Allele Specific Sequencing";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Chen D.-F., Dong L., Janzen M., Rabson A., Fraser P.;
RT   ;
RL   Submitted (20-MAR-2003) to the INSDC.
RL   HLA Laboratory, CBR Laboratories, The Center for Blood Research, 800
RL   Huntington Ave, Boston, MA 02115, USA
XX
DR   MD5; c5f11e2d18238dcefb5197c1050c5b51.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /clone="DR13JJJ"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q860E3"
FT                   /db_xref="IMGT/HLA:DRB1*13:56"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q860E3"
FT                   /protein_id="AAP21614.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEDRRAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 57 A; 66 C; 97 G; 50 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer