spacer

EBI Dbfetch

ID   AY259125; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY259125;
XX
DT   01-MAY-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens clone DR08GRS MHC class II antigen (HLA-DRB1) gene, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Chen D.-F., Dong L., Janzen M., Rabson A., Fraser P.;
RT   "Sequence Analysis of a DNA Sample with Unusual PCR-SSOP and PCR-SSP
RT   Patterns: Identification of a Novel DRB1*08 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Chen D.-F., Dong L., Janzen M., Rabson A., Fraser P.;
RT   ;
RL   Submitted (20-MAR-2003) to the INSDC.
RL   HLA Laboratory, CBR Laboratories, The Center for Blood Research, 800
RL   Huntington Ave, Boston, MA 02115, USA
XX
DR   MD5; cf56e482ef1e1e96cfd099b4751f68d8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /clone="DR08GRS"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q860E6"
FT                   /db_xref="IMGT/HLA:DRB1*08:25"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q860E6"
FT                   /protein_id="AAP21611.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 57 A; 65 C; 97 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaagacagg cgcgccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer