spacer

EBI Dbfetch

ID   AY253271; SV 1; linear; mRNA; STD; HUM; 765 BP.
XX
AC   AY253271;
XX
DT   10-APR-2003 (Rel. 75, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens MHC class Ib antigen (HLA-F) mRNA, HLA-F*0101 variant 3
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-765
RA   Liu Y., He X., Xu L., Zeng Y.;
RT   "Cloning of full-length HLA-F*0101 variant 3 cDNA from Han Chinese";
RL   Unpublished.
XX
RN   [2]
RP   1-765
RA   Liu Y., He X., Xu L., Zeng Y.;
RT   ;
RL   Submitted (08-MAR-2003) to the INSDC.
RL   Key Laboratory of Ministry of Education for Tissue Transplantation and
RL   Immunology, Jinan University, Shipai, Guangzhou, Guangdong 510632, China
XX
DR   MD5; 51ee309e06b04307a00e2337b3f320d5.
DR   Ensembl-Gn; ENSG00000137403; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204642; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206509; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229698; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235220; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237508; homo_sapiens.
DR   Ensembl-Tr; ENST00000259951; homo_sapiens.
DR   Ensembl-Tr; ENST00000334668; homo_sapiens.
DR   Ensembl-Tr; ENST00000359076; homo_sapiens.
DR   Ensembl-Tr; ENST00000376848; homo_sapiens.
DR   Ensembl-Tr; ENST00000376861; homo_sapiens.
DR   Ensembl-Tr; ENST00000383515; homo_sapiens.
DR   Ensembl-Tr; ENST00000420067; homo_sapiens.
DR   Ensembl-Tr; ENST00000434407; homo_sapiens.
DR   Ensembl-Tr; ENST00000440590; homo_sapiens.
DR   H-InvDB; HIT000085503_05.4.
DR   H-InvDB; HIT000085503_06.4.
DR   H-InvDB; HIT000085503_07.4.
DR   H-InvDB; HIT000085503_08.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..765
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /cell_type="peripheral leukocytes"
FT                   /db_xref="taxon:9606"
FT   CDS             1..765
FT                   /codon_start=1
FT                   /gene="HLA-F"
FT                   /product="MHC class Ib antigen"
FT                   /note="non-classical; similar to HLA-F*0101 but lacks exon
FT                   4; alternatively spliced"
FT                   /db_xref="GOA:P30511"
FT                   /db_xref="H-InvDB:HIT000085503_04.4"
FT                   /db_xref="HGNC:HGNC:4963"
FT                   /db_xref="IMGT/HLA:F*01:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30511"
FT                   /protein_id="AAO86775.1"
FT                   /translation="MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIA
FT                   VEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLR
FT                   RYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQI
FT                   TQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRAEQSPQPTIPIVGIVAGLVV
FT                   LGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAV"
XX
SQ   Sequence 765 BP; 152 A; 230 C; 254 G; 129 T; 0 other;
     atggcgcccc gaagcctcct cctgctgctc tcaggggccc tggccctgac cgatacttgg        60
     gcgggctccc actccttgag gtatttcagc accgctgtgt cgcggcccgg ccgcggggag       120
     ccccgctaca tcgccgtgga gtacgtagac gacacgcaat tcctgcggtt cgacagcgac       180
     gccgcgattc cgaggatgga gccgcgggag ccgtgggtgg agcaagaggg gccgcagtat       240
     tgggagtgga ccacagggta cgccaaggcc aacgcacaga ctgaccgagt ggccctgagg       300
     aacctgctcc gccgctacaa ccagagcgag gctgggtctc acaccctcca gggaatgaat       360
     ggctgcgaca tggggcccga cggacgcctc ctccgcgggt atcaccagca cgcgtacgac       420
     ggcaaggatt acatctccct gaacgaggac ctgcgctcct ggaccgcggc ggacaccgtg       480
     gctcagatca cccagcgctt ctatgaggca gaggaatatg cagaggagtt caggacctac       540
     ctggagggcg agtgcctgga gttgctccgc agatacttgg agaatgggaa ggagacgcta       600
     cagcgcgcag agcagtctcc ccagcccacc atccccatcg tgggcatcgt tgctggcctt       660
     gttgtccttg gagctgtggt cactggagct gtggtcgctg ctgtgatgtg gaggaagaag       720
     agctcagata gaaacagagg gagctactct caggctgcag tgtga                       765
//


spacer
spacer