spacer

EBI Dbfetch

ID   AY253269; SV 1; linear; mRNA; STD; HUM; 1041 BP.
XX
AC   AY253269;
XX
DT   10-APR-2003 (Rel. 75, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens MHC class Ib antigen (HLA-F) mRNA, HLA-F*0101 variant 1
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1041
RX   DOI; 10.1111/j.1399-0039.2004.00145.x.
RX   PUBMED; 14705989.
RA   He X., Xu L., Liu Y., Zeng Y.;
RT   "Identification of a novel HLA-F allele - HLA-F*010102";
RL   Tissue Antigens 63(2):181-183(2004).
XX
RN   [2]
RP   1-1041
RA   He X., Liu Y., Xu L., Zeng Y.;
RT   "Cloning of full-length HLA-F*0101 variant 1 cDNA from Han Chinese";
RL   Unpublished.
XX
RN   [3]
RP   1-1041
RA   He X., Liu Y., Xu L., Zeng Y.;
RT   ;
RL   Submitted (08-MAR-2003) to the INSDC.
RL   Key Laboratory of Ministry of Education for Tissue Transplantation and
RL   Immunology, Jinan University, Shipai, Guangzhou, Guangdong 510632, China
XX
DR   MD5; ac626e31e1ad9754b23741ad462795ab.
DR   Ensembl-Gn; ENSG00000137403; homo_sapiens.
DR   Ensembl-Gn; ENSG00000204642; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206509; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229698; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235220; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237508; homo_sapiens.
DR   Ensembl-Tr; ENST00000259951; homo_sapiens.
DR   Ensembl-Tr; ENST00000334668; homo_sapiens.
DR   Ensembl-Tr; ENST00000359076; homo_sapiens.
DR   Ensembl-Tr; ENST00000376848; homo_sapiens.
DR   Ensembl-Tr; ENST00000376861; homo_sapiens.
DR   Ensembl-Tr; ENST00000383515; homo_sapiens.
DR   Ensembl-Tr; ENST00000420067; homo_sapiens.
DR   Ensembl-Tr; ENST00000434407; homo_sapiens.
DR   Ensembl-Tr; ENST00000440590; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1041
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /cell_type="peripheral leukocytes"
FT                   /db_xref="taxon:9606"
FT   gene            1..1041
FT                   /gene="HLA-F"
FT                   /allele="HLA-F*0101 variant 1"
FT   CDS             1..1041
FT                   /codon_start=1
FT                   /gene="HLA-F"
FT                   /product="MHC class Ib antigen"
FT                   /note="non-classical; similar to HLA-F*0101 but lacks exon
FT                   7; alternatively spliced"
FT                   /db_xref="GOA:P30511"
FT                   /db_xref="H-InvDB:HIT000085501_03.4"
FT                   /db_xref="HGNC:HGNC:4963"
FT                   /db_xref="IMGT/HLA:F*01:01:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30511"
FT                   /protein_id="AAO86773.1"
FT                   /translation="MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIA
FT                   VEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLR
FT                   RYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQI
FT                   TQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATL
FT                   RCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCH
FT                   VQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGS
FT                   YSQAAV"
FT   variation       63
FT                   /gene="HLA-F"
FT                   /replace="g"
XX
SQ   Sequence 1041 BP; 212 A; 314 C; 342 G; 173 T; 0 other;
     atggcgcccc gaagcctcct cctgctgctc tcaggggccc tggccctgac cgatacttgg        60
     gcaggctccc actccttgag gtatttcagc accgctgtgt cgcggcccgg ccgcggggag       120
     ccccgctaca tcgccgtgga gtacgtagac gacacgcaat tcctgcggtt cgacagcgac       180
     gccgcgattc cgaggatgga gccgcgggag ccgtgggtgg agcaagaggg gccgcagtat       240
     tgggagtgga ccacagggta cgccaaggcc aacgcacaga ctgaccgagt ggccctgagg       300
     aacctgctcc gccgctacaa ccagagcgag gctgggtctc acaccctcca gggaatgaat       360
     ggctgcgaca tggggcccga cggacgcctc ctccgcgggt atcaccagca cgcgtacgac       420
     ggcaaggatt acatctccct gaacgaggac ctgcgctcct ggaccgcggc ggacaccgtg       480
     gctcagatca cccagcgctt ctatgaggca gaggaatatg cagaggagtt caggacctac       540
     ctggagggcg agtgcctgga gttgctccgc agatacttgg agaatgggaa ggagacgcta       600
     cagcgcgcag atcctccaaa ggcacacgtt gcccaccacc ccatctctga ccatgaggcc       660
     accctgaggt gctgggccct gggcttctac cctgcggaga tcacgctgac ctggcagcgg       720
     gatggggagg aacagaccca ggacacagag cttgtggaga ccaggcctgc aggggatgga       780
     accttccaga agtgggccgc tgtggtggtg ccttctggag aggaacagag atacacatgc       840
     catgtgcagc acgaggggct gccccagccc ctcatcctga gatgggagca gtctccccag       900
     cccaccatcc ccatcgtggg catcgttgct ggccttgttg tccttggagc tgtggtcact       960
     ggagctgtgg tcgctgctgt gatgtggagg aagaagagct cagatagaaa cagagggagc      1020
     tactctcagg ctgcagtgtg a                                                1041
//


spacer
spacer