Dbfetch

ID   AH012685; SV 2; linear; genomic DNA; STD; HUM; 3205 BP.
XX
AC   AH012685; AY233977-AY233979;
XX
DT   08-APR-2016 (Rel. 128, Created)
DT   08-APR-2016 (Rel. 128, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-Cw*07 variant allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3205
RX   DOI; 10.1111/j.0001-2815.2004.00224.x.
RX   PUBMED; 15140043.
RA   Paul P., Apgar J., Cook D.J., Ball E.J.;
RT   "Characterization of a new HLA-C allele: Cw*0719";
RL   Tissue Antigens 63(6):602-605(2004).
XX
RN   [2]
RP   1-3205
RA   Paul P., Apgar J., Kawczak P.R., Ball E.J.;
RT   "HLA-Cw*07 allelic variant";
RL   Unpublished.
XX
RN   [3]
RP   1-3205
RA   Paul P., Apgar J., Kawczak P.R., Ball E.J.;
RT   ;
RL   Submitted (11-FEB-2003) to the INSDC.
RL   Allogen Laboratories C-100, Cleveland Clinic Foundation, 9500 Euclid Ave,
RL   Cleveland, OH 44195, USA
XX
DR   MD5; b15b6275bb35df9304205d99595eca8d.
XX
CC   On or before Apr 6, 2016 this sequence version replaced
CC   gi:29569144, gi:29569145, gi:29569146, gi:29569143.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3205
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..>3205
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07 variant"
FT   mRNA            join(1..419,550..819,1070..1345,1929..2204,2329..2448,
FT                   2849..2881,2989..3036,3201..>3205)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07 variant"
FT                   /product="MHC class I antigen"
FT   5'UTR           1..346
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07 variant"
FT   CDS             join(347..419,550..819,1070..1345,1929..2204,2329..2448,
FT                   2849..2881,2989..3036,3201..3205)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*07 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q860B0"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /protein_id="AAO84019.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGG
FT                   KGGSCSQVACSNSAQGSDESLITCKA"
FT   gap             1587..1686
FT                   /estimated_length=unknown
FT   gap             2672..2771
FT                   /estimated_length=unknown
XX
SQ   Sequence 3205 BP; 564 A; 886 C; 958 G; 597 T; 200 other;
     cagacagatc cttgtccagg actcaggcac acagtgtgac aaagatgctt ggtgtaggag        60
     aagagggatc aggacgaagt cccaggtccc gggcggggct ctcagggtct caggctccaa       120
     gggccgtgtc tgcattgggg aggcgccgcg ttggggattc tccactcccc tgagtttcac       180
     ttctcccaac ctgcgtcggg tccttcttcc tgaatactca tgacgcgtcc ccaattccca       240
     ctcccattgg gtgtcgggtt ctagagaagc caatcagcgt ctccgcagtc ccggttctaa       300
     agtccccagt cacccacccg gactcacatt ctccccagag gccgagatgc gggtcatggc       360
     gccccgagcc ctcctcctgc tgctctcggg aggcctggcc ctgaccgaga cctgggcctg       420
     tgagtgcggg gttgggaggg aagcggcctc tgcggagagg agcgaggggc ccgcccggcg       480
     agggcgcagg acccggggag ccgcgcaggg aggtgggtcg ggcgggtctc agcccctcct       540
     cgcccccagg ctcccactcc atgaggtatt tcgacaccgc cgtgtcccgg cccggccgcg       600
     gagagccccg cttcatctca gtgggctacg tggacgacac gcagttcgtg cggttcgaca       660
     gcgacgccgc gagtccgaga ggggagccgc gggcgccgtg ggtggagcag gaggggccgg       720
     agtattggga ccgggagaca cagaactaca agcgccaggc acaggctgac cgagtgagcc       780
     tgcggaacct gcgcggctac tacaaccaga gcgaggacgg tgagtgaccc cggcccgggg       840
     cgcaggtcac gacccctccc catcccccac ggacggcccg ggtcgcccag agtctccccg       900
     tctgagatcc accccaaggt ggatctgcgg aacccgccca gaccctcgac cggagagagc       960
     cccagtcgcc tttacccggt ttcattttcg gtttaggcca aaatccccgc gggttggtcg      1020
     gggcggggcg gggctcgggg gactgggctg accgcggggg cggggccagg gtctcacacc      1080
     ctccagagga tgtctggctg cgacctgggg cccgacgggc gcctcctccg cgggtatgac      1140
     cagtccgcct acgacggcaa ggattacatc gccctgaacg aggacctgcg ctcctggacc      1200
     gccgcggaca ccgcggctca gatcacccag cgcaagttgg aggcggcccg tgcggcggag      1260
     cagctgagag cctacctgga gggcacgtgc gtggagtggc tccgcagata cctggagaac      1320
     gggaaggaga cgctgcagcg cgcaggtacc aggggcagtg gggagccttc cccatctcct      1380
     atagatctcc cgggatggcc tcccacgagg aggggaggaa aatgggatca gcactggaat      1440
     atcgccctcc cttgaatgga gaatggcatg agttttcctg agtttcctct gagggccccc      1500
     tctgctctct aggacaatta agggatgaag tctctgagga aatggagggg aagacagtcc      1560
     ctggaatact gatcaggggt ctccttnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1680
     nnnnnntttc tgagtcctgc agcctccact caggtcagga ccagaagtcg ctgttcctcc      1740
     ctcagagact agaactttcc aatgaatagg agattatccc aggtgcctgt gtccaggctg      1800
     gcgtctgggt tctgtgccgc cttccccacc ccaggtgtcc tgtccattct caggatggtc      1860
     acatgggcgc tgctggagtg tcccaagaga gatgcaaagt gtctgaattt tctgactctt      1920
     cccgtcagaa cccccaaaga cacacgtgac ccaccacccc ctctctgacc atgaggccac      1980
     cctgaggtgc tgggccctgg gcttctaccc tgcggagatc acactgacct ggcagcggga      2040
     tggggaggac cagacccagg acaccgagct tgtggagacc aggccagcag gagatggaac      2100
     cttccagaag tgggcagctg tggtggtgcc ttctggacaa gagcagagat acacgtgcca      2160
     tatgcagcac gaggggctgc aagagcccct caccctgagc tggggtaagg aggggaatgg      2220
     ggggtcacat ctcttatcag agaaagcaga agtccttctg gagcccttca gccgggtcag      2280
     ggctgaggct tgggggtcag ggcccctcac cttctcctct tttcccagag ccatcttccc      2340
     agcccaccat ccccatcatg ggcatcgttg ctggcctggc tgtcctggtt gtcctagctg      2400
     tccttggagc tgtggtcacc gctatgatgt gtaggaggaa gagctcaggt agggaagggg      2460
     tgaagagcgg ggtctgggtt ttcttgtccc actgggagtt tcaagcccca ggtagaagtg      2520
     tgccccgcct tgttactgga agcaccatcc acacatgggc catcccagcc tgggaccctg      2580
     tgtgccagca cttactcttt tgtgaagcac atgtgacaat gaaggacgga tgtatcacct      2640
     tgatgattat ggtgttgggg tccttgattc annnnnnnnn nnnnnnnnnn nnnnnnnnnn      2700
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2760
     nnnnnnnnnn ncaagactag gaggttcccc taagatcaca tggccctgcc tcctcccagt      2820
     cccctcatag ggcattttct tcccacaggt ggaaaaggag ggagctgctc tcaggttgcg      2880
     tgtaagtgat ggcggcgggc gtgtggagga gctcacctac tccataattc ctcttgtccc      2940
     acatctcctg cgggctctga ccaggtcttt ttttttgttc taccccaggc agcaacagtg      3000
     cccagggctc tgatgagtct ctcatcactt gtaaaggtga gattctgggg agctgaagtg      3060
     gtcgggggtg gggcagaggg aaaaggcctg ggtaatgggg attctttgat tgggacgttt      3120
     cgagtgtgtg gtgggccgtt cagagtgtca tcacttacca tgactgacct gaatttgttc      3180
     atgactattg tgttctgtag cctga                                            3205
//