spacer

EBI Dbfetch

ID   AH012648; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH012648; AY230856-AY230857;
XX
DT   29-JUL-2011 (Rel. 109, Created)
DT   29-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*02 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1111/j.1399-0039.2005.00413.x.
RX   PUBMED; 15896208.
RA   Canossi A., Aureli A., Piancatelli D., Liberatore G., Del Beato T.,
RA   Ozzella G., Tessitore A., Piazza A., Papola F., Casciani C.U., Adorno D.;
RT   "Characterization of a novel HLA-Cw*02 variant, Cw*0208, in a Caucasian
RT   individual";
RL   Tissue Antigens 65(6):575-579(2005).
XX
RN   [2]
RP   1-646
RA   Canossi A., Aureli A., Piancatelli D., Liberatore G., Del Beato T.,
RA   Di Rocco M., Ozzella G., Piazza A., Tessitore A., Casciani C.U., Adorno D.;
RT   ;
RL   Submitted (05-FEB-2003) to the INSDC.
RL   Istituto CNR Trapianti D'organo e l'Immunocitologia, Piazzale Collemaggio,
RL   L'Aquila 67100, Italy
XX
CC   On or before Jul 28, 2011 this sequence version replaced
CC   gi:29424051, gi:29424052, gi:29424050.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="sample E805, E863"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /tissue_type="blood"
FT                   /note="Caucasoid individual"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02 variant"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q860B3"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q860B3"
FT                   /protein_id="AAO73564.1"
FT                   /translation="SHSMRYFYTAVSRPSRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02 variant"
FT                   /number=2
FT   variation       61
FT                   /gene="HLA-Cw"
FT                   /note="compared to the HLA-Cw*020202 allele"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*02 variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 110 A; 169 C; 198 G; 69 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccagccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtacggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acagcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagtggaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer