spacer

EBI Dbfetch

ID   AH012612; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH012612; AY217668-AY217669;
XX
DT   29-JUL-2011 (Rel. 109, Created)
DT   29-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLC-C) gene, HLC-Cw*04011 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Rizzo M., Gedil M.A., Steiner N.K., Hurley C.K.;
RT   "Novel HLA-C allele";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Rizzo M., Gedil M.A., Steiner N.K., Hurley C.K.;
RT   ;
RL   Submitted (13-JAN-2003) to the INSDC.
RL   Oncology, Georgetown University Medical Center, 3970 Reservoir Road, NW,
RL   Washington, DC 20007, USA
XX
CC   On or before Jul 28, 2011 this sequence version replaced
CC   gi:29028240, gi:29028241, gi:29028239.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /isolate="GN00426"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLC-C"
FT                   /allele="HLC-Cw*04011"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLC-C"
FT                   /allele="HLC-Cw*04011"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLC-C"
FT                   /allele="HLC-Cw*04011"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q860A5"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q860A5"
FT                   /protein_id="AAO62346.1"
FT                   /translation="SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PREPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMFGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLC-C"
FT                   /allele="HLC-Cw*04011"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLC-C"
FT                   /allele="HLC-Cw*04011"
FT                   /number=3
XX
SQ   Sequence 646 BP; 106 A; 167 C; 200 G; 73 T; 100 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcctg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggagccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtttggct gcgacctggg gccggacggg       420
     cgcctcctcc gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac       480
     gaggatctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer