spacer

EBI Dbfetch

ID   AY216682; SV 1; linear; mRNA; STD; HUM; 972 BP.
XX
AC   AY216682;
XX
DT   11-FEB-2003 (Rel. 74, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens nonclassical MHC class I antigen (HLA-F) mRNA, HLA-F*0101
DE   variant allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-972
RA   He X., Xu L., Liu Y., Zeng Y.;
RT   "Nonclassical MHC class I HLA-F";
RL   Unpublished.
XX
RN   [2]
RP   1-972
RA   He X., Xu L., Liu Y., Zeng Y.;
RT   ;
RL   Submitted (10-JAN-2003) to the INSDC.
RL   Key Laboratory of Ministry of Education for Tissue Transplantation and
RL   Immunology, Jinan University, Shipai, Guangzhou, Guangdong 510632, China
XX
DR   MD5; a6885ad720744661753542fb5cad3dee.
DR   Ensembl-Gn; ENSG00000137403; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206509; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229698; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234487; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235220; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237508; homo_sapiens.
DR   Ensembl-Tr; ENST00000342322; homo_sapiens.
DR   Ensembl-Tr; ENST00000376844; homo_sapiens.
DR   Ensembl-Tr; ENST00000383516; homo_sapiens.
DR   Ensembl-Tr; ENST00000383626; homo_sapiens.
DR   Ensembl-Tr; ENST00000383627; homo_sapiens.
DR   Ensembl-Tr; ENST00000422439; homo_sapiens.
DR   Ensembl-Tr; ENST00000422711; homo_sapiens.
DR   Ensembl-Tr; ENST00000428296; homo_sapiens.
DR   Ensembl-Tr; ENST00000430472; homo_sapiens.
DR   Ensembl-Tr; ENST00000435058; homo_sapiens.
DR   Ensembl-Tr; ENST00000444891; homo_sapiens.
DR   Ensembl-Tr; ENST00000445657; homo_sapiens.
DR   Ensembl-Tr; ENST00000549422; homo_sapiens.
DR   Ensembl-Tr; ENST00000550932; homo_sapiens.
DR   Ensembl-Tr; ENST00000551780; homo_sapiens.
DR   Ensembl-Tr; ENST00000551832; homo_sapiens.
DR   Ensembl-Tr; ENST00000552082; homo_sapiens.
DR   Ensembl-Tr; ENST00000622145; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..972
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>972
FT                   /codon_start=1
FT                   /gene="HLA-F"
FT                   /product="nonclassical MHC class I antigen"
FT                   /db_xref="GOA:Q861F0"
FT                   /db_xref="H-InvDB:HIT000085316_03.4"
FT                   /db_xref="IMGT/HLA:F*01:01:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q861F0"
FT                   /protein_id="AAO37689.1"
FT                   /translation="SLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYV
FT                   DDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQ
FT                   SEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRF
FT                   YEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWA
FT                   LGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHE
FT                   GLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVM"
XX
SQ   Sequence 972 BP; 191 A; 300 C; 318 G; 163 T; 0 other;
     agcctcctcc tgctgctctc aggggccctg gccctgaccg atacttgggc aggctcccac        60
     tccttgaggt atttcagcac cgctgtgtcg cggcccggcc gcggggagcc ccgctacatc       120
     gccgtggagt acgtagacga cacgcaattc ctgcggttcg acagcgacgc cgcgattccg       180
     aggatggagc cgcgggagcc gtgggtggag caagaggggc cgcagtattg ggagtggacc       240
     acagggtacg ccaaggccaa cgcacagact gaccgagtgg ccctgaggaa cctgctccgc       300
     cgctacaacc agagcgaggc tgggtctcac accctccagg gaatgaatgg ctgcgacatg       360
     gggcccgacg gacgcctcct ccgcgggtat caccagcacg cgtacgacgg caaggattac       420
     atctccctga acgaggacct gcgctcctgg accgcggcgg acaccgtggc tcagatcacc       480
     cagcgcttct atgaggcaga ggaatatgca gaggagttca ggacctacct ggagggcgag       540
     tgcctggagt tgctccgcag atacttggag aatgggaagg agacgctaca gcgcgcagat       600
     cctccaaagg cacacgttgc ccaccacccc atctctgacc atgaggccac cctgaggtgc       660
     tgggccctgg gcttctaccc tgcggagatc acgctgacct ggcagcggga tggggaggaa       720
     cagacccagg acacagagct tgtggagacc aggcctgcag gggatggaac cttccagaag       780
     tgggccgctg tggtggtgcc ttctggagag gaacagagat acacatgcca tgtgcagcac       840
     gaggggctgc cccagcccct catcctgaga tgggagcagt ctccccagcc caccatcccc       900
     atcgtgggca tcgttgctgg ccttgttgtc cttggagctg tggtcactgg agctgtggtc       960
     gctgctgtga tg                                                           972
//


spacer
spacer