spacer

EBI Dbfetch

ID   AY216681; SV 1; linear; mRNA; STD; HUM; 1077 BP.
XX
AC   AY216681;
XX
DT   11-FEB-2003 (Rel. 74, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens nonclassical MHC class I antigen (HLA-E) mRNA, HLA-E*010301
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1077
RA   He X., Xu L., Liu Y., Zeng Y.;
RT   "Cloning of HLA-E cDNA from activated peripheral leukocytes";
RL   Unpublished.
XX
RN   [2]
RP   1-1077
RA   He X., Xu L., Liu Y., Zeng Y.;
RT   ;
RL   Submitted (10-JAN-2003) to the INSDC.
RL   Key Laboratory of Ministry of Education for Tissue Transplantation and
RL   Immunology, Jinan University, Shipai, Guangzhou, Guangdong 510632, China
XX
DR   MD5; 00ad03af9219178703074629a5637f7b.
DR   Ensembl-Gn; ENSG00000206493; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229252; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230254; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233904; homo_sapiens.
DR   Ensembl-Tr; ENST00000383597; homo_sapiens.
DR   Ensembl-Tr; ENST00000415289; homo_sapiens.
DR   Ensembl-Tr; ENST00000415649; homo_sapiens.
DR   Ensembl-Tr; ENST00000427936; homo_sapiens.
DR   H-InvDB; HIT000085315_05.4.
DR   H-InvDB; HIT000085315_06.4.
DR   H-InvDB; HIT000085315_07.4.
DR   H-InvDB; HIT000085315_08.4.
DR   H-InvDB; HIT000085315_09.4.
DR   H-InvDB; HIT000085315_10.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1077
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1077
FT                   /codon_start=1
FT                   /gene="HLA-E"
FT                   /product="nonclassical MHC class I antigen"
FT                   /db_xref="GOA:P13747"
FT                   /db_xref="H-InvDB:HIT000085315_04.4"
FT                   /db_xref="HGNC:HGNC:4962"
FT                   /db_xref="IMGT/HLA:E*01:03:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1KPR"
FT                   /db_xref="PDB:1KTL"
FT                   /db_xref="PDB:1MHE"
FT                   /db_xref="PDB:2ESV"
FT                   /db_xref="PDB:3AM8"
FT                   /db_xref="PDB:3BZE"
FT                   /db_xref="PDB:3BZF"
FT                   /db_xref="PDB:3CDG"
FT                   /db_xref="PDB:3CII"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13747"
FT                   /protein_id="AAO37688.1"
FT                   /translation="MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFIS
FT                   VGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRG
FT                   YYNQSEAGSHTLQWMHGCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQI
FT                   SEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATL
FT                   RCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCH
FT                   VQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGS
FT                   YSKAEWSDSAQGSESHSL"
FT   primer_bind     1..20
FT   primer_bind     complement(1055..1077)
XX
SQ   Sequence 1077 BP; 219 A; 315 C; 351 G; 192 T; 0 other;
     atggtagatg gaaccctcct tttactcctc tcggaggccc tggcccttac ccagacctgg        60
     gcgggctccc actccttgaa gtatttccac acttccgtgt cccggcccgg ccgcggggag       120
     ccccgcttca tctctgtggg ctacgtggac gacacccagt tcgtgcgctt cgacaacgac       180
     gccgcgagtc cgaggatggt gccgcgggcg ccgtggatgg agcaggaggg gtcagagtat       240
     tgggaccggg agacacggag cgccagggac accgcacaga ttttccgagt gaacctgcgg       300
     acgctgcgcg gctactacaa tcagagcgag gccgggtctc acaccctgca gtggatgcat       360
     ggctgcgagc tggggcccga cgggcgcttc ctccgcgggt atgaacagtt cgcctacgac       420
     ggcaaggatt atctcaccct gaatgaggac ctgcgctcct ggaccgcggt ggacacggcg       480
     gctcagatct ccgagcaaaa gtcaaatgat gcctctgagg cggagcacca gagagcctac       540
     ctggaagaca catgcgtgga gtggctccac aaatacctgg agaaggggaa ggagacgctg       600
     cttcacctgg agcccccaaa gacacacgtg actcaccacc ccatctctga ccatgaggcc       660
     accctgaggt gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcag       720
     gatggggagg gccataccca ggacacggag ctcgtggaga ccaggcctgc aggggatgga       780
     accttccaga agtgggcagc tgtggtggtg ccttctggag aggagcagag atacacgtgc       840
     catgtgcagc atgaggggct acccgagccc gtcaccctga gatggaagcc ggcttcccag       900
     cccaccatcc ccatcgtggg catcattgct ggcctggttc tccttggatc tgtggtctct       960
     ggagctgtgg ttgctgctgt gatatggagg aagaagagct caggtggaaa aggagggagc      1020
     tactctaagg ctgagtggag cgacagtgcc caggggtctg agtctcacag cttgtaa         1077
//


spacer
spacer