spacer

EBI Dbfetch

ID   AY206406; SV 1; linear; genomic DNA; STD; HUM; 940 BP.
XX
AC   AY206406;
XX
DT   05-MAR-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II HLA-DQ-alpha chain (HLA-DQA1) gene, HLA-DQA1*0602
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-940
RA   Simone A.E., Cordovado S.K., Hendrix M.M., Mueller P.W.;
RT   "Identification of a Novel HLA-DQA1*06 Allele Detected by Sequence-Based
RT   Typing";
RL   Unpublished.
XX
RN   [2]
RP   1-940
RA   Simone A.E., Cordovado S.K., Hendrix M.M., Mueller P.W.;
RT   ;
RL   Submitted (20-DEC-2002) to the INSDC.
RL   NCEH/DLS/MBB/DMRAS, Centers for Disease Control and Prevention, 4770 Buford
RL   Highway MS F-50, Atlanta, GA 30341, USA
XX
DR   MD5; 25d9049d05bc796828abc943b91e449c.
DR   Ensembl-Gn; ENSG00000196735; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206305; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232062; homo_sapiens.
DR   Ensembl-Gn; ENSG00000257473; homo_sapiens.
DR   Ensembl-Tr; ENST00000343139; homo_sapiens.
DR   Ensembl-Tr; ENST00000374949; homo_sapiens.
DR   Ensembl-Tr; ENST00000383251; homo_sapiens.
DR   Ensembl-Tr; ENST00000395363; homo_sapiens.
DR   Ensembl-Tr; ENST00000399675; homo_sapiens.
DR   Ensembl-Tr; ENST00000399678; homo_sapiens.
DR   Ensembl-Tr; ENST00000418023; homo_sapiens.
DR   Ensembl-Tr; ENST00000444296; homo_sapiens.
DR   Ensembl-Tr; ENST00000552745; homo_sapiens.
DR   IMGT/LIGM; AY206406.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..940
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="Caucasian"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>940
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*0602"
FT   mRNA            join(<1..246,659..>940)
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*0602"
FT                   /product="MHC class II HLA-DQ-alpha chain"
FT   CDS             join(<1..246,659..>940)
FT                   /codon_start=3
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*0602"
FT                   /product="MHC class II HLA-DQ-alpha chain"
FT                   /note="binds to the T cell receptor; similar to
FT                   HLA-DQA1*060101 except for nucleotide changes in intron 2
FT                   and exon 3"
FT                   /db_xref="GOA:P01909"
FT                   /db_xref="HGNC:HGNC:4942"
FT                   /db_xref="IMGT/HLA:DQA1*06:02"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01909"
FT                   /protein_id="AAO47362.1"
FT                   /translation="DHVASYGVNLYQSYGPSGQFTHEFDGDEQFYVDLGRKETVWCLPV
FT                   LRQFRFDPQFALTNIAVTKHNLNILIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLIC
FT                   LVDNIFPPVVNITWLSNGHSVTEGVSETRFLSKSDHSFFKISYLTFLPSADEIYDCKVE
FT                   HWGLDEPLLKHW"
FT   exon            <1..246
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*0602"
FT                   /number=2
FT   exon            659..940
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*0602"
FT                   /number=3
FT   variation       811
FT                   /gene="HLA-DQA1"
FT                   /replace="a"
FT                   /note="compared to HLA-DQA1*060101; results in arginine to
FT                   serine amino acid change"
XX
SQ   Sequence 940 BP; 235 A; 247 C; 193 G; 265 T; 0 other;
     ctgaccatgt tgcctcttat ggtgtaaact tgtaccagtc ttacggtccc tctggccagt        60
     tcacccatga atttgatgga gacgagcagt tctacgtgga cctggggagg aaggagactg       120
     tctggtgttt gcctgttctc agacaattta gatttgaccc gcaatttgca ctgacaaaca       180
     tcgctgtgac aaaacacaac ttgaacatcc tgattaaacg ctccaactct accgctgcta       240
     ccaatggtat gtgtccacaa ttctgcccct ctttactgat ctatcccttc ataccaagtt       300
     tcattatttt acttccaaga ggtccccaga tcttctcatg gcaattgctg aaattctatc       360
     acttcccgtc tctaaaatca catattccca tgtaatacaa gggtctttcc attatccatt       420
     cattaaatcc ttctaggaga ggtctcatca acctcctact ttattaaaca tgcccacaga       480
     gagaagggca taggaataaa gcagaggcaa tgtgtcgttg ctcccaagca gaaggtaaat       540
     aagacctctt tgactatcag gtggtgaaat gctggtagga gggctcttcc aggatgtaat       600
     gaagaagctc atggcagagc tattcacact tcacatcagt gctgtttcct caccacagag       660
     gttcctgagg tcacagtgtt ttccaagtct cccgtgacgc tgggtcagcc caacaccctc       720
     atctgtcttg tggacaacat ctttcctcct gtggtcaaca tcacatggct gagcaatggg       780
     cactcagtca cagaaggtgt ttctgagacc cgcttcctct ccaagagtga tcattccttc       840
     ttcaagatca gttacctcac cttcctccct tctgctgatg agatttatga ctgcaaggtg       900
     gagcactggg gcctggacga gcctcttctg aaacactggg                             940
//


spacer
spacer