spacer

EBI Dbfetch

ID   AY194116; SV 1; linear; genomic DNA; STD; HUM; 1838 BP.
XX
AC   AY194116;
XX
DT   25-FEB-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*4405 allele, exons 2
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1838
RA   Iglehart B.A., Leffell M.S.;
RT   "HLA B*4405 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1838
RA   Iglehart B.A., Leffell M.S.;
RT   ;
RL   Submitted (10-DEC-2002) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St., Baltimore, MD
RL   21205, USA
XX
DR   MD5; 21b877090c604988cce98133e62c8ab7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1838
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<54..323,567..842,1418..1693,1787..>1838)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(<54..323,567..842,1418..1693,1787..>1838)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="leukocyte antigen; major histocompatability complex
FT                   B"
FT                   /db_xref="GOA:Q861F5"
FT                   /db_xref="IMGT/HLA:B*44:05:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q861F5"
FT                   /protein_id="AAO42515.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLC
FT                   VESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTV
FT                   PIVGIVAGLA"
FT   exon            54..323
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            567..842
FT                   /gene="HLA-B"
FT                   /number=3
FT   exon            1418..1693
FT                   /gene="HLA-B"
FT                   /number=4
FT   exon            1787..>1838
FT                   /gene="HLA-B"
FT                   /number=5
XX
SQ   Sequence 1838 BP; 353 A; 578 C; 578 G; 329 T; 0 other;
     ggagccgcgc cgggaggagg gtcgggcggg tctcagcccc tcctcgcccc caggctccca        60
     ctccatgagg tatttctaca ccgccatgtc ccggcccggc cgcggggagc cccgcttcat       120
     caccgtgggc tacgtggacg acacgctgtt cgtgaggttc gacagcgacg ccacgagtcc       180
     gaggaaggag ccgcgggcgc catggataga gcaggagggg ccggagtatt gggaccggga       240
     gacacagatc tccaagacca acacacagac ttaccgagag aacctgcgca ccgcgctccg       300
     ctactacaac cagagcgagg ccggtgagtg accccggccc ggggcgcagg tcacgactcc       360
     ccatccccca cgtacggccc gggtcgcccc gagtctccgg gtccgagatc cgcccccgag       420
     gccgcgggac ccgcccagac cctcgaccgg cgagagcccc aggcgcgttt acccggtttc       480
     attttcagtt gaggccaaaa tccccgcggg ttggtcgggg cggggcgggg ctcgggggac       540
     ggggctgacc gcggggccgg ggccagggtc tcacatcatc cagaggatgt acggctgcga       600
     cgtggggccg gacgggcgcc tcctccgcgg gtatgaccag tacgcctacg acggcaagga       660
     ttacatcgcc ctgaacgagg acctgagctc ctggaccgcg gcggacaccg cggctcagat       720
     cacccagcgc aagtgggagg cggcccgtgt ggcggagcag gacagagcct acctggaggg       780
     cctgtgcgtg gagtcgctcc gcagatacct ggagaacggg aaggagacgc tgcagcgcgc       840
     gggtaccagg ggcagtgggg agccttcccc atctcctata ggtcgccggg gatggcctcc       900
     cacgagaaga ggaggaaaat gggatcagcg ctagaatgtc gccctccctt gaatggagaa       960
     tggcatgagt tttcctgagt ttcctctgag ggccccctct tctctctagg acaattaagg      1020
     gatgacgtct ctgaggaaat ggaggggaag acagtcccta gaatactgat caggggtccc      1080
     ctttgacccc tgcagcagcc ttgggaaccg tgacttttcc tctcaggcct tgttctctgc      1140
     ctcacactca gtgtgtttgg ggctctgatt ccagcacttc tgagtcactt tacctccact      1200
     cagatcagga gcagaagtcc ctgttccccg ctcagagact cgaactttcc aatgaatagg      1260
     agattatccc aggtgcctgc gtccaggctg gtgtctgggt tctgtgcccc ttccccaccc      1320
     caggtgtcct gtccattctc aggctggtca catgggtggt cctagggtgt cccatgagag      1380
     atgcaaagcg cctgaatttt ctgactcttc ccatcagacc ccccaaagac acatgtgacc      1440
     caccacccca tctctgacca tgaggtcacc ctgaggtgct gggccctggg cttctaccct      1500
     gcggagatca cactgacctg gcagcgggat ggcgaggacc aaactcagga caccgagctt      1560
     gtggagacca gaccagcagg agatagaacc ttccagaagt gggcagctgt ggtggtgcct      1620
     tctggagaag agcagagata cacatgccat gtacagcatg aggggctgcc gaagcccctc      1680
     accctgagat ggggtaagga gggggatgag gggtcatatc tcttctcagg gaaagcagga      1740
     gcccttcagc agggtcaggg cccctcatct tcccttcctt tcccagagcc gtcttcccag      1800
     tccaccgtcc ccatcgtggg cattgttgct ggcctggc                              1838
//


spacer
spacer