spacer

EBI Dbfetch

ID   AH012442; SV 2; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   AH012442; AY188943-AY188945;
XX
DT   29-JUL-2011 (Rel. 109, Created)
DT   29-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*44 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RA   Canossi A., Aureli A., Piancatelli D., Liberatore G., Del Beato T.,
RA   Di Rocco M., Papola F., Casciani C.U., Adorno D.;
RT   "A novel HLA-B*44 allele variant in a Caucasoid bone marrow donor";
RL   Unpublished.
XX
RN   [2]
RP   1-1022
RA   Canossi A., Aureli A., Piancatelli D., Liberatore G., Del Beato T.,
RA   Di Rocco M., Papola F., Casciani C.U., Adorno D.;
RT   ;
RL   Submitted (29-NOV-2002) to the INSDC.
RL   Istituto CNR Trapianti D'organo e l'Immunocitologia, Piazzale Collemaggio,
RL   L'Aquila 67100, Italy
XX
CC   On or before Jul 28, 2011 this sequence version replaced
CC   gi:27729528, gi:27729529, gi:27729530, gi:27729527.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="E840"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /isolation_source="Caucasoid bone marrow donor"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1022
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44 variant"
FT   mRNA            join(<1..270,371..646,747..>1022)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q860B7"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q860B7"
FT                   /protein_id="AAO18660.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLC
FT                   VESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44 variant"
FT                   /number=3
FT   variation       445
FT                   /gene="HLA-B"
FT                   /note="compared to HLA-B*44021 allele"
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..1022
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44 variant"
FT                   /number=4
XX
SQ   Sequence 1022 BP; 182 A; 256 C; 269 G; 115 T; 200 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccagagg atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggtatga ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcaggacaga gcctacctgg agggcctgtg cgtggagtcg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnaccc cccaaagaca catgtgaccc accaccccat       780
     ctctgaccat gaggtcaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gcgaggacca aactcaggac accgagcttg tggagaccag       900
     accagcagga gatagaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga       960
     gcagagatac acatgccatg tacagcatga ggggctgccg aagcccctca ccctgagatg      1020
     gg                                                                     1022
//


spacer
spacer