spacer

EBI Dbfetch

ID   AY180974; SV 1; linear; genomic DNA; STD; HUM; 940 BP.
XX
AC   AY180974;
XX
DT   22-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQA1) gene, HLA-DQA1*040102 allele,
DE   exons 2 and 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-940
RX   DOI; 10.1111/j.1399-0039.2005.00389.x.
RX   PUBMED; 15853899.
RA   Cordovado S.K., Hancock L.N., Simone A.E., Hendrix M., Mueller P.W.;
RT   "High-resolution genotyping of HLA-DQA1 in the GoKinD study and
RT   identification of novel alleles HLA-DQA1*040102, HLA-DQA1*0402 and
RT   HLA-DQA1*0404";
RL   Tissue Antigens 65(5):448-458(2005).
XX
RN   [2]
RP   1-940
RA   Cordovado S.K., Simone A.E., Hendrix M.M., Mueller P.W.;
RT   ;
RL   Submitted (15-NOV-2002) to the INSDC.
RL   NCEH/DLS/MBB/DMRAS, Centers for Disease Control and Prevention, 4770 Buford
RL   Highway, MS F-50, Atlanta, GA 30341, USA
XX
DR   MD5; 3838e696d49738edbc30c4171899d253.
DR   IMGT/LIGM; AY180974.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..940
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="Caucasian individual"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>940
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*040102"
FT   CDS             join(<1..246,659..>940)
FT                   /codon_start=3
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*040102"
FT                   /product="MHC class II antigen"
FT                   /note="HLA-DQA1; HLA-DQ-alpha chain; binds to T-cell
FT                   receptor"
FT                   /db_xref="GOA:Q861G0"
FT                   /db_xref="IMGT/HLA:DQA1*04:01:02:01"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q861G0"
FT                   /protein_id="AAO23559.1"
FT                   /translation="DHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPV
FT                   LRQFRFDPQFALTNIAVTKHNLNILIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLIC
FT                   LVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVE
FT                   HWGLDEPLLKHW"
FT   exon            <1..246
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*040102"
FT                   /number=2
FT   exon            659..>940
FT                   /gene="HLA-DQA1"
FT                   /allele="HLA-DQA1*040102"
FT                   /number=3
XX
SQ   Sequence 940 BP; 237 A; 245 C; 192 G; 266 T; 0 other;
     ctgaccatgt tgcctcttat ggtgtaaact tgtaccagtc ttacggtccc tctggccagt        60
     acacccatga atttgatgga gacgagcagt tctacgtgga cctggggagg aaggagactg       120
     tctggtgttt gcctgttctc agacaattta gatttgaccc gcaatttgca ctgacaaaca       180
     tcgctgtgac aaaacacaac ttgaacatcc tgattaaacg ctccaactct actgctgcta       240
     ccaatggtat gtgtccacaa ttctgcccct ctttactgat ctatcccttc ataccaagtt       300
     tcattatttt acttccaaga ggtccccaga tcttctcatg gcaattgctg aaattctatc       360
     acttcccatc tctaaaatca catattccca tgtaatacaa gggtctttcc attatccatt       420
     cattaaatcc ttctaggaga ggtctcatca acctcctact ttattaaaca tgcccacaga       480
     gagaagggca taggaataaa gcagaggcaa tgtgtcgttg ctcccaagca gaaggtaaat       540
     aagacctctt tgactatcag gtggtgaaat gctggtagga gggctcttcc aggatgtaat       600
     gcagaagctc atggcagagc tattcacact tcacatcagt gctgtttcct caccacagag       660
     gttcctgagg tcacagtgtt ttccaagtct cctgtgacgc tgggtcagcc caacaccctc       720
     atctgtcttg tggacaacat ctttcctcct gtggtcaaca tcacatggct gagcaatggg       780
     cactcagtca cagaaggtgt ttctgagacc agcttcctct ccaagagtga tcattccttc       840
     ttcaagatca gttacctcac cttcctccct tctgctgatg agatttatga ctgcaaggtg       900
     gagcactggg gcctggacga gcctcttctg aaacactggg                             940
//


spacer
spacer