spacer

EBI Dbfetch

ID   AY174184; SV 1; linear; genomic DNA; STD; HUM; 269 BP.
XX
AC   AY174184;
XX
DT   10-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1111 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-269
RA   Vayntrub T., Lo B.;
RT   "Confirmatory Sequence of HLA Class II DRB1*1111";
RL   Unpublished.
XX
RN   [2]
RP   1-269
RA   Vayntrub T., Lo B.;
RT   ;
RL   Submitted (01-NOV-2002) to the INSDC.
RL   Stanford Histocompatibility Laboratory, Stanford Medical School Blood
RL   Center, 800 Welch Road, Palo Alto, CA 94304, USA
XX
DR   MD5; f7b6ec2aa87809e3402723805438c3e3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..269
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>266
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>266
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q861H2"
FT                   /db_xref="IMGT/HLA:DRB1*11:11:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q861H2"
FT                   /protein_id="AAO17056.1"
FT                   /translation="FLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVT
FT                   ELGRPDEEYWNSQKDFLEDERAAVDTYCRHNYGVGESFTVQRR"
FT   exon            <1..266
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 269 BP; 57 A; 60 C; 98 G; 54 T; 0 other;
     tttcttggag tactctacgt ctgagtgtca tttcttcaat gggacggagc gggtgcggtt        60
     cctggacaga tacttctata accaagagga gtacgtgcgc ttcgacagcg acgtggggga       120
     gttccgggcg gtgacggagc tggggcggcc tgatgaggag tactggaaca gccagaagga       180
     cttcctggaa gacgagcggg ccgcggtgga cacctactgc agacacaact acggggttgg       240
     tgagagcttc acagtgcagc ggcgaggtg                                         269
//


spacer
spacer