spacer

EBI Dbfetch

ID   AY174180; SV 1; linear; genomic DNA; STD; HUM; 247 BP.
XX
AC   AY174180;
XX
DT   10-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1506 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-247
RA   Lo B.;
RT   "Confirmatory Sequence of HLA Class II DRB1*1506";
RL   Unpublished.
XX
RN   [2]
RP   1-247
RA   Lo B.;
RT   ;
RL   Submitted (01-NOV-2002) to the INSDC.
RL   Stanford Histocompatibility Laboratory, Stanford Medical School Blood
RL   Center, 800 Welch Road, Palo Alto, CA 94304, USA
XX
DR   MD5; 9cc532415fa41681f3c47d5b39c5a80b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..247
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>244
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>244
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q861H6"
FT                   /db_xref="IMGT/HLA:DRB1*15:06:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q861H6"
FT                   /protein_id="AAO17052.1"
FT                   /translation="ECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAATELGRPDA
FT                   EYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRR"
FT   exon            <1..244
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 247 BP; 50 A; 60 C; 95 G; 42 T; 0 other;
     gagtgtcatt tcttcaatgg gacggagcgg gtgcggttcc tggacagata cttctataac        60
     caggaggagt ccgtgcgctt cgacagcgac gtgggggagt tccgggcggc gacggagctg       120
     gggcggcctg acgctgagta ctggaacagc cagaaggaca tcctggagca ggcgcgggcc       180
     gcggtggaca cctactgcag acacaactac ggggttgtgg agagcttcac agtgcagcgg       240
     cgaggtg                                                                 247
//


spacer
spacer