Dbfetch

ID   AY172512; SV 1; linear; genomic DNA; STD; HUM; 267 BP.
XX
AC   AY172512;
XX
DT   21-DEC-2002 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1101 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-267
RX   DOI; 10.1111/j.1399-0039.2004.00262.x.
RX   PUBMED; 15245378.
RA   Garino E., Berrino M., Mazzola G., Boccadoro M., Bruno B., Bertinetto F.,
RA   Bertola L., Caropreso P., Frisaldi E., Marin F., Panniello M.L., Tondat F.,
RA   Dall'Omo A.M.;
RT   "Identification of a new HLA-DRB1 allele in three members of an Italian
RT   family";
RL   Tissue Antigens 64(2):210-212(2004).
XX
RN   [2]
RP   1-267
RA   Bertola L., Garino E., Mazzola G., Berrino M., Tondat F., Dall'Omo A.M.,
RA   Curtoni E.S.;
RT   ;
RL   Submitted (04-NOV-2002) to the INSDC.
RL   Dept. Genetic, Biology and Biochemistry, University of Turin, via Santena
RL   19, Turin 10126, Italy
XX
DR   MD5; f61b4a23eab70254a2dc08c0de38cc89.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..267
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>267
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1101 variant"
FT   mRNA            <1..>267
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1101 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>267
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1101 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q8HWG5"
FT                   /db_xref="IMGT/HLA:DRB1*11:49:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWG5"
FT                   /protein_id="AAN86038.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYARFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            <1..>267
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1101 variant"
FT                   /number=2
FT   variation       98
FT                   /gene="HLA-DRB1"
FT                   /replace="t"
XX
SQ   Sequence 267 BP; 57 A; 62 C; 96 G; 52 T; 0 other;
     cgtttcttgg agtactctac gtctgagtgt catttcttca atgggacgga gcgggtgcgg        60
     ttcctggaca gatacttcta taaccaagag gagtacgcgc gcttcgacag cgacgtgggg       120
     gagttccggg cggtgacgga gctggggcgg cctgatgagg agtactggaa cagccagaag       180
     gacttcctgg aagacaggcg ggccgcggtg gacacctact gcagacacaa ctacggggtt       240
     ggtgagagct tcacagtgca gcggcga                                           267
//