Dbfetch

ID   AY170862; SV 1; linear; genomic DNA; STD; HUM; 269 BP.
XX
AC   AY170862;
XX
DT   08-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1106 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-269
RA   Lo B.;
RT   ;
RL   Submitted (30-OCT-2002) to the INSDC.
RL   Stanford Histocompatibility Laboratory, Stanford Medical School Blood
RL   Center, 800 Welch Road, Palo Alto, CA 94304, USA
XX
DR   MD5; 50edd5c3a2e73c97a2f541c433d1e8b1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..269
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>266
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>266
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q861H9"
FT                   /db_xref="IMGT/HLA:DRB1*11:06:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q861H9"
FT                   /protein_id="AAO16556.1"
FT                   /translation="FLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVT
FT                   ELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGAVESFTVQRR"
FT   exon            <1..266
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 269 BP; 57 A; 60 C; 98 G; 54 T; 0 other;
     tttcttggag tactctacgt ctgagtgtca tttcttcaat gggacggagc gggtgcggtt        60
     cctggacaga tacttctata accaagagga gtacgtgcgc ttcgacagcg acgtggggga       120
     gttccgggcg gtgacggagc tggggcggcc tgatgaggag tactggaaca gccagaagga       180
     cttcctggaa gacaggcggg ccgcggtgga cacctattgc agacacaact acggggctgt       240
     ggagagcttc acagtgcagc ggcgaggtg                                         269
//