spacer

EBI Dbfetch

ID   AH012202; SV 2; linear; genomic DNA; STD; HUM; 573 BP.
XX
AC   AH012202; AY162382-AY162385;
XX
DT   29-JUL-2011 (Rel. 109, Created)
DT   29-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*07012 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-573
RX   DOI; 10.1034/j.1399-0039.2003.00110.x.
RX   PUBMED; 14617049.
RA   Delfino L., Morabito A., Ferrara G.B.;
RT   "HLA-C sequence based typing: nucleotide analysis from exon 1 through exon
RT   8. Identification of a new allele: Cw*0718";
RL   Tissue Antigens 62(5):418-425(2003).
XX
RN   [2]
RP   1-573
RA   Delfino L., Morabito A., Ferrara G.B.;
RT   "HLA-Cw*07012 sequence updating: from exon 6 to exon 8";
RL   Unpublished.
XX
RN   [3]
RP   1-573
RA   Delfino L., Morabito A., Ferrara G.B.;
RT   ;
RL   Submitted (11-OCT-2002) to the INSDC.
RL   Immunogenetics, National Cancer Research Institute, Largo R. Benzi, 10,
RL   Genova, GE 16132, Italy
XX
DR   Ensembl-Gn; ENSG00000204525; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233841; homo_sapiens.
DR   Ensembl-Tr; ENST00000376228; homo_sapiens.
DR   Ensembl-Tr; ENST00000424832; homo_sapiens.
XX
CC   On or before Jul 28, 2011 this sequence version replaced
CC   gi:26892207, gi:26892208, gi:26892209, gi:26892210, gi:26892206.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..573
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>573
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07012"
FT   mRNA            join(<1..120,239..271,375..422,569..>573)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07012"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..120,239..271,375..422,569..573)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07012"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q8HWG1"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWG1"
FT                   /protein_id="AAN84536.1"
FT                   /translation="PSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGS
FT                   CSQAACSNSAQGSDESLITCKA"
FT   exon            1..120
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07012"
FT                   /number=5
FT   gap             121..220
FT                   /estimated_length=unknown
FT   exon            239..271
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07012"
FT                   /number=6
FT   gap             272..371
FT                   /estimated_length=unknown
FT   exon            375..422
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07012"
FT                   /number=7
FT   gap             423..522
FT                   /estimated_length=unknown
FT   exon            569..>573
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*07012"
FT                   /number=8
XX
SQ   Sequence 573 BP; 53 A; 71 C; 74 G; 75 T; 300 other;
     agccatcttc ccagcctacc atccccatca tgggcatcgt tgctggcctg gctgtcctgg        60
     ttgtcctagc tgtccttgga gctgtggtca ccgctatgat gtgtaggagg aagagctcag       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ggcattttct tcccacaggt       240
     ggaaaaggag ggagctgctc tcaggctgcg tnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ncaggcagca acagtgccca gggctctgat gagtctctca tcacttgtaa       420
     agnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnttaccatg actgacctga       540
     atttgttcat gactattgtg ttctgtagcc tga                                    573
//


spacer
spacer