spacer

EBI Dbfetch

ID   AH012569; SV 2; linear; genomic DNA; STD; HUM; 1369 BP.
XX
AC   AH012569; AY158885-AY158886;
XX
DT   29-JUL-2011 (Rel. 109, Created)
DT   29-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*020109 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1369
RA   Iglehart B.A., Berger S.A., Schaefer W.J., Zachary A.A., Leffell M.S.;
RT   "SBT confirmation of a new A2 allele not detected by allele group SSP";
RL   Hum. Immunol. 62(Supplement 1):S47-S47(2001).
XX
RN   [2]
RP   1-1369
RA   Iglehart B.A., Leffell M.S.;
RT   ;
RL   Submitted (04-OCT-2002) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St., Baltimore, MD
RL   21205, USA
XX
DR   MD5; 48ecc4015dbe03dbab568a30bbf2104c.
DR   Ensembl-Gn; ENSG00000227715; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235657; homo_sapiens.
DR   Ensembl-Tr; ENST00000413609; homo_sapiens.
DR   Ensembl-Tr; ENST00000438861; homo_sapiens.
DR   Ensembl-Tr; ENST00000453057; homo_sapiens.
DR   Ensembl-Tr; ENST00000453975; homo_sapiens.
DR   Ensembl-Tr; ENST00000455882; homo_sapiens.
DR   Ensembl-Tr; ENST00000457879; homo_sapiens.
DR   Ensembl-Tr; ENST00000547271; homo_sapiens.
DR   Ensembl-Tr; ENST00000547522; homo_sapiens.
XX
CC   On or before Jul 28, 2011 this sequence version replaced
CC   gi:28883281, gi:28883282, gi:28883280.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1369
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1369
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020109"
FT   mRNA            join(<75..344,586..861,1094..>1369)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020109"
FT                   /product="MHC class I antigen"
FT   CDS             join(<75..344,586..861,1094..>1369)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020109"
FT                   /product="MHC class I antigen"
FT                   /note="human leukocyte antigen"
FT                   /db_xref="GOA:Q540M3"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q540M3"
FT                   /protein_id="AAO49823.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            75..344
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020109"
FT                   /number=2
FT   exon            586..861
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020109"
FT                   /number=3
FT   gap             994..1093
FT                   /estimated_length=unknown
FT   exon            1094..1369
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*020109"
FT                   /number=4
XX
SQ   Sequence 1369 BP; 240 A; 401 C; 441 G; 187 T; 100 other;
     tggcgggggc gcaggacccg ggaagccgcg ccgggaggag ggtcgggcgg gtctcagcca        60
     ctcctcgtcc ccaggctctc actccatgag gtatttcttc acatccgtgt cccggcccgg       120
     ccgcggggag ccccgcttca tcgccgtggg ctacgtggac gacacgcagt tcgtgcggtt       180
     cgacagcgac gccgcgagcc agaggatgga gccgcgggcg ccgtggatag agcaggaggg       240
     tccggagtat tgggacgggg agacacggaa agtgaaggcc cactcacaga ctcaccgagt       300
     ggacctgggg accctgcgcg gctactacaa ccagagcgag gccggtgagt gaccccggcc       360
     cggggcgcag gtcacgacct ctcatccccc acggacgggc caggtcgccc acagtctccg       420
     ggtccgagat ccgccccgaa gccgcgggac cccgagaccc ttgccccggg agaggcccag       480
     gcgcctttac ccggtttcat tttcagttta ggccaaaaat ccccccaggt tggtcggggc       540
     ggggcggggc tcgggggacc gggctgaccg cggggtccgg gccaggttct cacaccgtcc       600
     agaggatgta tggctgcgac gtggggtcgg actggcgctt cctccgcggg taccaccagt       660
     acgcctacga cggcaaggat tacatcgccc tgaaagagga cctgcgctct tggaccgcgg       720
     cggacatggc agctcagacc accaagcaca agtgggaggc ggcccatgtg gcggagcagt       780
     tgagagccta cctggagggc acgtgcgtgg agtggctccg cagatacctg gagaacggga       840
     aggagacgct gcagcgcacg ggtaccaggg gccacggggc gcctccctga tcgcctgtag       900
     atctcccggg ctggcctccc acaaggaggg gagacaattg ggaccaacac tagaatatcg       960
     ccctccctct ggtcctgagg gagaggaatc ctcnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnacgcccc caaaacgcat atgactcacc acgctgtctc tgaccatgaa      1140
     gccaccctga ggtgctgggc cctgagcttc taccctgcgg agatcacact gacctggcag      1200
     cgggatgggg aggaccagac ccaggacacg gagctcgtgg agaccaggcc tgcaggggat      1260
     ggaaccttcc agaagtgggc ggctgtggtg gtgccttctg gacaggagca gagatacacc      1320
     tgccatgtgc agcatgaggg tttgcccaag cccctcaccc tgagatggg                  1369
//


spacer
spacer