spacer

EBI Dbfetch

ID   AY152671; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY152671;
XX
DT   16-OCT-2002 (Rel. 73, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1 variant allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Chen D.-F., Sydara V., Wan M., Ma Y., Hou C., Hall S., Janzen M.,
RA   Bordner J., Rabson A., Fraser P.A.;
RT   "A New DRB1 Allele Identified by Single Allele Sequencing";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Chen D.-F., Sydara V., Wan M., Ma Y., Hou C., Hall S., Janzen M.,
RA   Bordner J., Rabson A., Fraser P.A.;
RT   ;
RL   Submitted (20-SEP-2002) to the INSDC.
RL   HLA Laboratory, CBR Laboratories, The Center for Blood Research, 800
RL   Huntington Ave, Boston, MA 02115, USA
XX
DR   MD5; b888a994c3f32278d21abb9cd46c2f5f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q8HWS6"
FT                   /db_xref="IMGT/HLA:DRB1*01:10"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWS6"
FT                   /protein_id="AAN38832.1"
FT                   /translation="RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 62 C; 98 G; 51 T; 0 other;
     cacgtttctt gtggcagctt aagtttgaat gtcatttctt caatgggacg gagcgggtgc        60
     ggttgctgga aagatgcatc tataaccaag aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer