Dbfetch

ID   AY141137; SV 1; linear; genomic DNA; STD; HUM; 283 BP.
XX
AC   AY141137;
XX
DT   08-OCT-2002 (Rel. 73, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB5) gene, HLA-DRB5*DELIJ allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-283
RA   Greville W.D., Chapman G., Hogbin J.-P., Velickovic Z.;
RT   "Novel HLA-DRB5 allele found by sequence based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-283
RA   Greville W.D., Chapman G., Hogbin J.-P., Velickovic Z.;
RT   ;
RL   Submitted (14-AUG-2002) to the INSDC.
RL   Molecular Genetics Laboratory, Tissue Typing Services, Australian Red Cross
RL   Blood Service, 153 Clarence Street, Sydney, NSW 2000, Australia
XX
DR   MD5; 3e8a4749f83f0be1168d69a13a1e6871.
DR   Ensembl-Gn; ENSG00000198502; homo_sapiens.
DR   Ensembl-Tr; ENST00000374975; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..283
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <14..>283
FT                   /gene="HLA-DRB5"
FT                   /product="MHC class II antigen"
FT   CDS             <14..>283
FT                   /codon_start=3
FT                   /gene="HLA-DRB5"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q30154"
FT                   /db_xref="HGNC:HGNC:4953"
FT                   /db_xref="IMGT/HLA:DRB5*01:11"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1FV1"
FT                   /db_xref="PDB:1H15"
FT                   /db_xref="PDB:1HQR"
FT                   /db_xref="PDB:1ZGL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q30154"
FT                   /protein_id="AAN28924.1"
FT                   /translation="RFLQQDKYECHFFNGTERVRFLHRDIYNQEEDLRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFTVQRR"
FT   exon            14..283
FT                   /gene="HLA-DRB5"
FT                   /number=2
XX
SQ   Sequence 283 BP; 63 A; 71 C; 101 G; 48 T; 0 other;
     cgtgtcccca cagcacgttt cttgcagcag gataagtatg agtgtcattt cttcaacggg        60
     acggagcggg tgcggttcct gcacagagac atctataacc aagaggagga cttgcgcttc       120
     gacagcgacg tgggggagta ccgggcggtg acggagctgg ggcggcctga cgctgagtac       180
     tggaacagcc agaaggacat cctggagcag gcgcgggccg cggtggacac ctactgcaga       240
     cacaactacg gggttggtga gagcttcaca gtgcagcggc gag                         283
//