spacer

EBI Dbfetch

ID   AY138123; SV 1; linear; mRNA; STD; HUM; 806 BP.
XX
AC   AY138123;
XX
DT   01-SEP-2003 (Rel. 77, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB3) mRNA, HLA-DRB3*03011 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-806
RA   Spierings E., Zegveld S.T., Goulmy E.;
RT   "HLA-DRB3*03011 sequence complete mRNA";
RL   Unpublished.
XX
RN   [2]
RP   1-806
RA   Spierings E., Zegveld S.T., Goulmy E.;
RT   ;
RL   Submitted (31-JUL-2002) to the INSDC.
RL   Immunohematology and Blood Transfusion, Leiden University Medical Center,
RL   Albinusdreef 2, Leiden, ZH 2333ZA, The Netherlands
XX
DR   MD5; 5bef1f1953327c0a2f29dd5874bc9663.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
DR   Ensembl-Tr; ENST00000426847; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..806
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..806
FT                   /gene="HLA-DRB3"
FT                   /allele="HLA-DRB3*03011"
FT   CDS             1..801
FT                   /codon_start=1
FT                   /gene="HLA-DRB3"
FT                   /product="MHC class II antigen"
FT                   /note="leukocyte antigen"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="H-InvDB:HIT000250777.14"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*03:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="AAN15205.1"
FT                   /translation="MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELLKSECH
FT                   FFNGTERVRFLERYFHNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGQV
FT                   DNYCRHNYGVVESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
XX
SQ   Sequence 806 BP; 172 A; 203 C; 259 G; 172 T; 0 other;
     atggtgtgtc tgaagctccc tggaggctcc agcttggcag cgttgacagt gacactgatg        60
     gtgctgagct cccgactggc tttcgctggg gacacccgac cacgtttctt ggagctgctt       120
     aagtctgagt gtcatttctt caatgggacg gagcgggtgc ggttcctgga gagatacttc       180
     cataaccagg aggagttcgt gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg       240
     gagctggggc ggcctgtcgc cgagtcctgg aacagccaga aggacctcct ggagcagaag       300
     cggggccagg tggacaatta ctgcagacac aactacgggg ttgtggagag cttcacagtg       360
     cagcggcgag tccatcctca ggtgactgtg tatcctgcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgttc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaatg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccataatgga       540
     gactggacct tccagaccct ggtgatgcta gaaacagttc ctcggagtgg agaggtttac       600
     acttgccaag tggagcaccc aagcgtaaca agccctctca cagtggaatg gagagcacgg       660
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gctttgtgct gggcctgctc       720
     ttccttgggg ccgggctgtt catctacttc aggaatcaga aaggacactc tggacttcag       780
     ccaacaggat tcctgagctg actcga                                            806
//


spacer
spacer