spacer

EBI Dbfetch

ID   AY134744; SV 1; linear; genomic DNA; STD; HUM; 1135 BP.
XX
AC   AY134744;
XX
DT   29-AUG-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*5610 allele, exons 2
DE   and 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1135
RX   DOI; 10.1034/j.1399-0039.2003.00031.x.
RX   PUBMED; 12694576.
RA   Wu G.-G., Cheng L.-H., Zhou D., Deng Z.-H., Zou H.-Y., Wei T.-L., Li Z.,
RA   Li D.-C., Gao S.-Q., Zhao T.-M.;
RT   "Identification of a novel allele HLA-B*5610 in a Chinese potential bone
RT   marrow donor";
RL   Tissue Antigens 61(3):256-258(2003).
XX
RN   [2]
RP   1-1135
RA   Wu G.-G., Cheng L.-H., Zhou D., Deng Z.-H., Zou H.-Y., Li D.-C., Wei T.-L.,
RA   Li Z., Zhao T.-M.;
RT   ;
RL   Submitted (22-JUL-2002) to the INSDC.
RL   MCIGS/NIAID, National Institutes of Health, 50 South Drive, Bethesda, MD
RL   20892, USA
XX
DR   MD5; ae4624452b69ada8669d12907128760f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1135
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<113..382,628..>903)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(<113..382,628..>903)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="human leucocyte antigen B; antigen presenting
FT                   molecule"
FT                   /db_xref="GOA:Q8MGZ3"
FT                   /db_xref="IMGT/HLA:B*56:10"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MGZ3"
FT                   /protein_id="AAM95705.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            113..382
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            628..903
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 1135 BP; 213 A; 352 C; 409 G; 161 T; 0 other;
     agggaaatgg cctctgtggg gaggagcgag gggaccgcag gcgggggcgc aggacccggg        60
     gagccgcgcc gggaggaggg tctggcgggt ctcagcccct cctcgccccc aggctcccac       120
     tccatgaggt atttctacac cgccatgtcc cggcccggcc gcggggagcc ccgcttcatc       180
     gcagtgggct acgtggacga cacgcagttc gtgaggttcg acagcgacgc cgcgagtccg       240
     agagaggagc cgcgggcgcc gtggatagag caggaggggc cggagtattg ggaccggaac       300
     acacagatct acaaggccca ggcacagact gaccgagaga gcctgcggaa cctgcgcggc       360
     tactacaacc agagcgaggc cggtgagtga ccccggcccg gggcgcaggt cacgactccc       420
     catcccccac gtacggcccg ggtcgccccg agtctccggg tccgagatcc gcctccctga       480
     ggccgcggga cccgcccaga ccctcgaccg gcgagagccc caggcgcgtt tacccggttt       540
     cattttcagt tgaggccaaa atccccgcgg gttggtcggg gcggggcggg gctcggggga       600
     cggggctgac cgcggggccg gggccagggt ctcacaccct ccagaggatg tacggctgcg       660
     acctggggcc ggacgggcgc ctcctccgcg ggcataacca gttagcctac gacggcaagg       720
     attacatcgc cctgaacgag gacctgagct cctggaccgc ggcggacacc gcggctcaga       780
     tcacccagcg caagtgggag gcggcccgtg tggcggagca gctgagagcc tacctggagg       840
     gcacgtgcgt ggagtggctc cgcagatacc tggagaacgg gaaggagacg ctgcagcgcg       900
     cgggtaccag gggcagtggg gagccttccc catctcctat aggtcgccgg ggatggcctc       960
     ccacgagaag aggaggaaaa tgggatcagc gctagaatgt cgccctccct tgaatggaga      1020
     atggcatgag ttttcctgag tttcctctga gggccccctc ttctctctag gacaattaag      1080
     ggatgacgtc tctgaggaaa tggaggggaa gacagtccct agaatactga tcagg           1135
//


spacer
spacer