spacer

EBI Dbfetch

ID   AY134743; SV 1; linear; genomic DNA; STD; HUM; 1249 BP.
XX
AC   AY134743;
XX
DT   29-AUG-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*1114 allele, exons 1
DE   through 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1249
RX   DOI; 10.1034/j.1399-0039.2003.00032.x.
RX   PUBMED; 12694575.
RA   Wu G.-G., Cheng L.-H., Li Z., Deng Z.-H., Zou H.-Y., Wei T.-L., Zhou D.,
RA   Li D.-C., Gao S.-Q., Zhao T.-M.;
RT   "Identification of a new HLA allele, A*1114, in a Chinese family";
RL   Tissue Antigens 61(3):253-255(2003).
XX
RN   [2]
RP   1-1249
RA   Wu G.-G., Cheng L.-H., Li Z., Deng Z.-H., Zou H.-Y., Li D.-C., Wei T.-L.,
RA   Zhou D., Zhao T.-M.;
RT   ;
RL   Submitted (22-JUL-2002) to the INSDC.
RL   MCIGS/NIAID, National Institutes of Health, 50 South Drive, Bethesda, MD
RL   20892, USA
XX
DR   MD5; 7af4feed3fcd73432f0669b8bbf5b3e6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1249
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..27,158..427,669..>944)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..27,158..427,669..>944)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /note="human leucocyte antigen A; antigen presenting
FT                   molecule"
FT                   /db_xref="GOA:Q8MGZ4"
FT                   /db_xref="IMGT/HLA:A*11:14"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MGZ4"
FT                   /protein_id="AAM95704.1"
FT                   /translation="LALTQTWAGSHSMRYFYTSVSRPGRGKPRFIAVGYVDDTQFVRFD
FT                   SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQ
FT                   IMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAARRAEQ
FT                   QRAYLEGRCVEWLRRYLENGKETLQRT"
FT   exon            <1..27
FT                   /gene="HLA-A"
FT                   /number=1
FT   exon            158..427
FT                   /gene="HLA-A"
FT                   /number=2
FT   exon            669..944
FT                   /gene="HLA-A"
FT                   /number=3
XX
SQ   Sequence 1249 BP; 234 A; 389 C; 438 G; 188 T; 0 other;
     ccctggccct gacccagacc tgggcgggtg agtgcggggt cgggagggaa accgcctctg        60
     cggggagaag caaggggccc tcctggcggg ggcgcaggac cgggggagcc gcgccgggag       120
     gagggtcggg caggtctcag ccactgctcg cccccaggct cccactccat gaggtatttc       180
     tacacctccg tgtcccggcc cggccgcggg aagccccgct tcatcgccgt gggctacgtg       240
     gacgacacgc agttcgtgcg gttcgacagc gacgccgcga gccagaggat ggagccgcgg       300
     gcgccgtgga tagagcagga ggggccggag tattgggacc aggagacacg gaatgtgaag       360
     gcccagtcac agactgaccg agtggacctg gggaccctgc gcggctacta caaccagagc       420
     gaggacggtg agtgaccccg gcccggggcg caggtcacga cccctcatcc cccacggacg       480
     ggccaggtgg cccacagtct ccgggtccga gatccacccc gaagccgcgg gaccccgaga       540
     cccttgcccc gggagaggcc caggcgcctt tacccggttt cattttcagt ttaggccaaa       600
     aatccccccg ggttggtcgg ggccgggcag ggcttggggg actgggctga ccgcggggtc       660
     ggggccaggt tctcacacca tccagataat gtatggctgc gacgtggggc cggacgggcg       720
     cttcctccgc gggtaccggc aggacgccta cgacggcaag gattacatcg ccctgaacga       780
     ggacctgcgc tcttggaccg cggcggacat ggcagctcag atcaccaagc gcaagtggga       840
     ggcggcccgt cgggcggagc agcagagagc ctacctggag ggccggtgcg tggagtggct       900
     ccgcagatac ctggagaacg ggaaggagac gctgcagcgc acgggtacca ggggccacgg       960
     ggcgcctccc tgatcgccta tagatctccc gggctggcct cccacaagga ggggagacaa      1020
     ttgggaccaa cactagaata tcaccctccc tctggtcctg agggagagga atcctcctgg      1080
     gtttccagat cctgtaccag agagtgactc tgaggttccg ccctgctctc tgacacaatt      1140
     aagggataaa atctctgaag gagtgacggg aagacgatcc ctcgaatact gatgagtggt      1200
     tccctttgac accggcagca gccttgggcc cgtgactttt cctctcagg                  1249
//


spacer
spacer