Dbfetch

ID   AY130301; SV 1; linear; genomic DNA; STD; HUM; 298 BP.
XX
AC   AY130301;
XX
DT   12-SEP-2002 (Rel. 73, Created)
DT   28-OCT-2009 (Rel. 102, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*27 new allele, exons 1
DE   and 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-298
RX   DOI; 10.1111/j.1399-0039.2005.00421.x.
RX   PUBMED; 15982258.
RA   Alonso-Nieto M., Garcia-Sanchez F., Lillo R., Balas A., Blanco L.,
RA   Aviles-Egea M.J., Zarapuz L., Vicario J.L.;
RT   "Four new HLA class I alleles in Cauacasoids";
RL   Tissue Antigens 66(1):51-53(2005).
XX
RN   [2]
RP   1-298
RA   Garcia-Sanchez F., Vicario J.L., Alonso M., Balas A., Lillo R.;
RT   "Four new HLA class I alleles in Caucasoids";
RL   Unpublished.
XX
RN   [3]
RP   1-298
RA   Garcia-Sanchez F., Vicario J.L., Alonso M., Balas A., Lillo R.;
RT   ;
RL   Submitted (10-JUL-2002) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre, Menendez-Pelayo 65, Madrid
RL   28009, Spain
XX
DR   MD5; d1701a936bbbce575ccdc7af2814e896.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..298
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>298
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 new"
FT   mRNA            join(<1..101,231..>298)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 new"
FT                   /product="MHC class I antigen"
FT   exon            <1..101
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 new"
FT                   /number=1
FT   5'UTR           <1..28
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 new"
FT   CDS             join(29..101,231..>298)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 new"
FT                   /product="MHC class I antigen"
FT                   /note="membrane protein"
FT                   /db_xref="IMGT/HLA:B*27:05:05"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWS8"
FT                   /protein_id="AAN05037.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FI"
FT   exon            231..>298
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 new"
FT                   /number=2
XX
SQ   Sequence 298 BP; 40 A; 104 C; 113 G; 41 T; 0 other;
     cggactcaga atctcctcag acgccgagat gcgggtcacg gcgccccgaa ccctcctcct        60
     gctgctctgg ggggcagtgg ccctgaccga gacctgggct ggtgagtgcg gggtcggcag       120
     ggaaatggcc tctgtgggga ggagcgaggg gaccgcaggc gggggcgcag gacccgggga       180
     gccgcgccgg gaggagggtc gggcgggtct cagcccctcc tcgcccccag gctcccactc       240
     catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc gcttcatc         298
//