Dbfetch

ID   AY129430; SV 1; linear; genomic DNA; STD; HUM; 450 BP.
XX
AC   AY129430;
XX
DT   12-SEP-2002 (Rel. 73, Created)
DT   27-JUL-2009 (Rel. 101, Last updated, Version 6)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1405 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-450
RX   DOI; 10.1111/j.0001-2815.2004.00282.x.
RX   PUBMED; 15304013.
RA   Chen Z.X., Tsan S.G., Dang C.W., Chu C.C., Lin M., Lee Y.J.;
RT   "Identification of two new HLA-DRB1 alleles: HLA-DRB1*1350 and
RT   DRB1*140502";
RL   Tissue Antigens 64(3):300-303(2004).
XX
RN   [2]
RP   1-450
RA   Chen Z.X., Chu C.-C., Dang C.W., Lin M., Lee Y.-J.;
RT   "A new HLA-DRB1*1405 variant";
RL   Unpublished.
XX
RN   [3]
RP   1-450
RA   Chen Z.X., Chu C.-C., Dang C.W., Lin M., Lee Y.-J.;
RT   ;
RL   Submitted (08-JUL-2002) to the INSDC.
RL   Departments of Pediatrics and Medical Research, Mackay Memorial Hospital,
RL   92, Sec 2, Chung-San N Rd, Taipei 10449, Taiwan
XX
DR   MD5; 243c07c66520d8c71098def8eb6dd151.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..450
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..450
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1405"
FT   mRNA            <164..>433
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1405"
FT                   /product="MHC class II antigen"
FT   CDS             <164..>433
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1405"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q8HWS9"
FT                   /db_xref="IMGT/HLA:DRB1*14:05:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWS9"
FT                   /protein_id="AAN05013.1"
FT                   /translation="RFLEYSTSECQFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRR"
FT   exon            164..433
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1405"
FT                   /number=2
XX
SQ   Sequence 450 BP; 79 A; 116 C; 172 G; 83 T; 0 other;
     gacagaggag gagcccctgg gctgcagatg gtgggcgttg cggcgggggc cggttaaggt        60
     tcccagtgcc tgcaccccgc ccagggagcc ccggatggtg gcgtcactgt cagtgtcttc       120
     tcaggaggcc gcctgtgtga ctggatcgtt cgtgtcccca cagcacgttt cttggagtac       180
     tctacgtctg agtgtcaatt cttcaatggg acggagcggg tgcggttcct ggacagatac       240
     ttccataacc aggaggagtt cgtgcgcttc gacagcgacg tgggggagta ccgggcggtg       300
     acggagctgg ggcggcctga tgccgagtac tggaacagcc agaaggacct cctggagcgg       360
     aggcgggccg aggtggacac ctattgcaga cacaactacg gggttgtgga gagcttcaca       420
     gtgcagcggc gaggtgagcg cggcgcgggg                                        450
//