spacer

EBI Dbfetch

ID   AY128675; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   AY128675;
XX
DT   02-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*74 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RA   Fichter K.M., Peng L., Baxter-Lowe L.A.;
RT   ;
RL   Submitted (03-JUL-2002) to the INSDC.
RL   Immunogenetics & Transplantation Laboratory, UCSF Department of Surgery, 45
RL   Castro Street, San Francisco, CA 94114, USA
XX
DR   MD5; 7359e4366969199ecceac7e22712582e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,512..>787)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q8HWG9"
FT                   /db_xref="IMGT/HLA:A*74:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HWG9"
FT                   /protein_id="AAN01239.1"
FT                   /translation="SHSMRYFFTSVSPPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAHSQTDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGP
FT                   DGRLLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /number=2
FT   variation       40
FT                   /gene="HLA-A"
FT                   /replace="g"
FT                   /note="results in arginine to proline substitution"
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /number=3
XX
SQ   Sequence 787 BP; 141 A; 249 C; 284 G; 113 T; 0 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccc gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggtttgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccact cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggccgggg gcgcaggtca       300
     ggacccctca tcccccacgg acgggccagg tcgcccacag tctccgggtc cgagatccac       360
     cccgaagccg cgggaccccg agacccttgc cccgggagag gcccaggcgc ctttacccgg       420
     tttcattttc agtttaggcc aaaaatcccc ccgggttggt cggggccgga cggggctcgg       480
     gggactgggc tgaccgtggg gtcggggcca ggttctcaca ccatccagat gatgtatggc       540
     tgcgacgtgg ggccggacgg gcgcctcctc cgcgggtacc agcaggacgc ctacgacggc       600
     aaggattaca tcgccttgaa cgaggacctg cgctcttgga ccgcggcgga catggcggct       660
     cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcagttgag agcctacctg       720
     gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//


spacer
spacer