Dbfetch

ID   AY128674; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   AY128674;
XX
DT   02-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*24 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RA   Fichter K.M., Peng L., Baxter-Lowe L.A.;
RT   ;
RL   Submitted (03-JUL-2002) to the INSDC.
RL   Immunogenetics & Transplantation Laboratory, UCSF Department of Surgery, 45
RL   Castro Street, San Francisco, CA 94114, USA
XX
DR   MD5; a568fc664bccab4d087f096b974fe424.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,512..>787)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*24:02:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q540S1"
FT                   /protein_id="AAN01238.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /number=2
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /number=3
FT   variation       588
FT                   /gene="HLA-A"
FT                   /replace="c"
XX
SQ   Sequence 787 BP; 145 A; 252 C; 281 G; 109 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctca tcccccacgg acgggccggg tcgcccacag tctccgggtc cgagatccac       360
     cccgaagccg cgggaccccg agacccttgc cccgggagag gcccaggcgc cttaacccgg       420
     tttcattttc agtttaggcc aaaaatcccc ccgggttggt cggggccggg cggggctcgg       480
     gggactgggc tgaccgcggg gtcggggcca ggttctcaca ccctccagat gatgtttggc       540
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc accagtatgc ctacgacggc       600
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcggct       660
     cagatcacca agcgcaagtg ggaggcggcc catgtggcgg agcagcagag agcctacctg       720
     gagggcacgt gcgtggacgg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//