spacer

EBI Dbfetch

ID   AY124571; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AY124571;
XX
DT   25-JUL-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*07 variant allele,
DE   exon 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Cantwell L., Hepner J., Diviney M., Kanaan C., Boyle A., Holdsworth R.,
RA   Tait B.;
RT   "New HLA-B*07 allele identified";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Cantwell L., Hepner J., Diviney M., Kanaan C., Boyle A., Holdsworth R.,
RA   Tait B.;
RT   ;
RL   Submitted (20-JUN-2002) to the INSDC.
RL   Victorian Transplantation and Immunogenetics Service, Australian Red Cross
RL   Blood Service - Victoria, C/O 2nd Floor, Rotary Bone Marrow Research
RL   Centre, Royal Parade, Parkville, Melbourne, VIC 3050, Australia
XX
DR   MD5; 9321577ff7defb24ba406dd64d782023.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p23"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(AY124570.1:<1..270,1..>276)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(AY124570.1:<1..270,1..>276)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q8MHN6"
FT                   /db_xref="IMGT/HLA:B*07:31"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MHN6"
FT                   /protein_id="AAM78035.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 276 BP; 54 A; 87 C; 102 G; 33 T; 0 other;
     ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcatga ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggac aagctggagc gcgctg                                 276
//


spacer
spacer