Dbfetch

ID   AH011732; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH011732; AY124570-AY124571;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens chromosome 6 MHC class I antigen (HLA-B) gene, HLA-B*07
DE   variant allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Cantwell L., Hepner J., Diviney M., Kanaan C., Boyle A., Holdsworth R.,
RA   Tait B.;
RT   "New HLA-B*07 allele identified";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Cantwell L., Hepner J., Diviney M., Kanaan C., Boyle A., Holdsworth R.,
RA   Tait B.;
RT   ;
RL   Submitted (20-JUN-2002) to the INSDC.
RL   Victorian Transplantation and Immunogenetics Service, Australian Red Cross
RL   Blood Service - Victoria, C/O 2nd Floor, Rotary Bone Marrow Research
RL   Centre, Royal Parade, Parkville, Melbourne, VIC 3050, Australia
XX
DR   MD5; d3e1ab7d9184fec1ac4032f4021619ce.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:21928190, gi:21928191, gi:21928189.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p23"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07 variant"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07 variant"
FT                   /product="MHC class I antigen"
FT                   /protein_id="AAM78035.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07 variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 111 A; 173 C; 193 G; 69 T; 100 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcatga ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggac aagctggagc gcgctg                      646
//