spacer

EBI Dbfetch

ID   AY122288; SV 1; linear; genomic DNA; STD; HUM; 245 BP.
XX
AC   AY122288;
XX
DT   09-AUG-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*0813 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-245
RA   Rizzuto G.A., Hurley C.K.;
RT   "Extension of known sequence, HLA-DRB1*0813";
RL   Unpublished.
XX
RN   [2]
RP   1-245
RA   Rizzuto G.A., Hurley C.K.;
RT   ;
RL   Submitted (14-JUN-2002) to the INSDC.
RL   Oncology, Georgetown University Medical Center, 3970 Reservoir Road, NW,
RL   Washington, DC 20007, USA
XX
DR   MD5; 9a741a1776cb85470631685900d4cb5e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..245
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="GN00422"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>245
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>245
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q8MGZ7"
FT                   /db_xref="IMGT/HLA:DRB1*08:13"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MGZ7"
FT                   /protein_id="AAM88570.1"
FT                   /translation="ECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVTELGRPDA
FT                   EYWNSQKDLLEDRRALVDTYCRHNYGVGESFTVQRR"
FT   exon            <1..245
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 245 BP; 53 A; 57 C; 91 G; 44 T; 0 other;
     tgagtgttat ttcttcaatg ggacggagcg ggtgcggttc ctggacagat acttctataa        60
     ccaagaggag tacgtgcgct tcgacagcga cgtgggggag taccgggcgg tgacggagct       120
     ggggcggcct gatgccgagt actggaacag ccagaaggac ctcctggaag acaggcgggc       180
     cctggtggac acctactgca gacacaacta cggggttggt gagagcttca cggtgcagcg       240
     gcgag                                                                   245
//


spacer
spacer