spacer

EBI Dbfetch

ID   AY102648; SV 1; linear; mRNA; STD; HUM; 820 BP.
XX
AC   AY102648;
XX
DT   16-JUN-2002 (Rel. 72, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) mRNA, HLA-B*51 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-820
RA   Gimferrer I., Arias M.-T., Fabregat V., de Pablo R., Vilches C., Lozano F.;
RT   "Identification of a new HLA-B*51 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-820
RA   Gimferrer I., Arias M.-T., Fabregat V., de Pablo R., Vilches C., Lozano F.;
RT   ;
RL   Submitted (13-MAY-2002) to the INSDC.
RL   Servei d'Immunologia, Hospital Clinic, Villarroel 170, Barcelona 08036,
RL   Spain
XX
DR   MD5; 9dc207e2ff9ede8f17c670bd814c0c03.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..820
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>820
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="includes exons 2, 3 and 4"
FT                   /db_xref="GOA:Q8MGZ8"
FT                   /db_xref="IMGT/HLA:B*51:30"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MGZ8"
FT                   /protein_id="AAM50088.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
XX
SQ   Sequence 820 BP; 181 A; 255 C; 269 G; 115 T; 0 other;
     tcccactcca tgaggtattt ctacaccgcc atgtcccggc ccggccgcgg ggagccccgc        60
     ttcattgcag tgggctacgt ggacgacacc cagttcgtga ggttcgacag cgacgccgcg       120
     agtccgagga cggagccccg ggcgccatgg atagagcagg aggggccgga gtattgggac       180
     cggaacacac agatcttcaa gaccaacaca cagacttacc gagagaacct gcggatcgcg       240
     ctccgctact acaaccagag cgaggccggg tctcacactt ggcagacgat gtatggctgc       300
     gacgtggggc cggacgggcg cctcctccgc gggcataacc agtacgccta cgacggcaaa       360
     gattacatcg ccctgaacga ggacctgagc tcctggaccg cggcggacac cgcggctcag       420
     atcacccagc gcaagtggga ggcggcccgt gaggcggagc agctgagagc ctacctggag       480
     ggcctgtgcg tggagtggct ccgcagacac ctggagaacg ggaaggagac gctgcagcgc       540
     gcggaccccc caaagacaca cgtgacccac caccccgtct ctgaccatga ggccaccctg       600
     aggtgctggg ccctgggctt ctaccctgcg gagatcacac tgacctggca gcgggatggc       660
     gaggaccaaa ctcaggacac tgagcttgtg gagaccagac cagcaggaga tggaaccttc       720
     cagaagtggg cagctgtggt ggtgccttct ggagaagagc agagatacac atgccatgta       780
     cagcatgagg ggctgccgaa gcccctcacc ctgagatggg                             820
//


spacer
spacer