Dbfetch

ID   AY095537; SV 2; linear; genomic DNA; STD; HUM; 1930 BP.
XX
AC   AY095537;
XX
DT   17-FEB-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, MICA*A7
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1930
RX   DOI; 10.1034/j.1399-0039.2002.600608.x.
RX   PUBMED; 12542746.
RA   Rueda B., Pascual M., Lopez-Nevot M.A., Gonzalez E., Martin J.;
RT   "A new allele within the transmembrane region of the human MICA gene with
RT   seven GCT repeats";
RL   Tissue Antigens 60(6):526-528(2002).
XX
RN   [2]
RP   1-1930
RA   Rueda B.M., Pascual M., Lopez-Nevot M.A., Martin J.;
RT   ;
RL   Submitted (11-APR-2002) to the INSDC.
RL   Immunology, Instituto 'Lopez-Neyra', Ventanilla 11, Granada 18001, Spain
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1930
RA   Rueda B.M., Pascual M., Lopez-Nevot M.A., Martin J.;
RT   ;
RL   Submitted (20-FEB-2003) to the INSDC.
RL   Immunology, Instituto 'Lopez-Neyra', Ventanilla 11, Granada 18001, Spain
XX
DR   MD5; dd9ac069b3a00b1e005e34b0785ad206.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AY095537.
XX
CC   On Feb 20, 2003 this sequence version replaced gi:28394238.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1930
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1783..>1923
FT                   /gene="MICA"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             <1783..>1923
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /product="MHC class I chain-related protein A"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="IMGT/HLA:MICA*050"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="AAM34484.1"
FT                   /translation="KVLVLQSHWQTFHVSAVAAAAAAAIFVIIIFYVCCCKKKTSAAEG
FT                   P"
FT   exon            <1783..>1923
FT                   /gene="MICA"
FT                   /number=5
XX
SQ   Sequence 1930 BP; 441 A; 506 C; 585 G; 398 T; 0 other;
     agccccacag tcttcgttat aacctcacgg tgctgtccgg ggatggatct gtgcagtcag        60
     ggtttctcgc tgaggtacat ctggatggtc agcccttcct gcgctgtgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaaggtgag agtcggcagg ggcaagagtg actggagagg ccttttccag       300
     aaaagttagg ggcagagagc agggacctgt atctacccac tggatctggc tcaggctggg       360
     ggtgaggaat gggggtcagt ggaactcagc agggaggtga gccggcactc agcccacaca       420
     gggaggcatg gaggagggcc agggaggcgt accccctggg ctgagttcct cacttgggtg       480
     gaaaggtgat gggttcggga atggagaagt cactgctggg tgggggcagg cttgcattcc       540
     ttccaggaga ttagggtctg tgagatccat gaagacaaca gcaccaggag ctcccagcat       600
     ttctactacg atggggagct cttcctctcc caaaacctgg agactgagga atggacaatg       660
     ccccagtcct ccagagctca gaccttggcc atgaacgtca ggaatttctt gaaggaagat       720
     gccatgaaga ccaagacaca ctatcacgct atgcatgcag actgcctgca ggaactacgg       780
     cgatatctaa aatccggcgt agtcctgagg agaacaggta ccgacgctgg ccaggggctc       840
     tcctctccct ccaattctgc tagagttgcc tcacctccca gatgtgtcca gggaaaccct       900
     ccctgtgcta tggatgaagg catttcctgt tggcacatcg tgtcctgatt ttcctctatt       960
     gttagagcca ctggataaag acagtgggtc agggactgga ccatccagtg ttgtaatcag      1020
     ggcaagtaga ggaccctccg acagaatcct gagcctgggg tgggtgtcag gcaggagagg      1080
     aaggcttcag ggccagggct gccccctctg cctcccagcc tgcccatcct ggagagttcc      1140
     ctcctggccc cacaacccag gagtccaccc ctgacatccc cctcctcagc atcaatgtgg      1200
     ggatcccaga gcctgaggca cagtcccatg gcccatcctc ctgccagcct ggaagaactg      1260
     ggccccagag tgaggacaga cttgcaggtc aggggtccca gagggcttca gccagagtga      1320
     gaacagtgaa gagaaacagc cctgttcctc tcccctcctt agaggggagc agggcttcac      1380
     tggctctgcc ctttcttctc cagtgccccc catggtgaat gtcacccgca gcgaggcctc      1440
     agagggcaac attaccgtga catgcagggc ttctggcttc tatccctgga atatcacact      1500
     gagctggcgt caggatgggg tatctttgag ccacgacacc cagcagtggg gggatgtcct      1560
     gcctgatggg aatggaacct accagacctg ggtggccacc aggatttgcc aaggagagga      1620
     gcagaggttc acctgctaca tggaacacag cgggaatcac agcactcacc ctgtgccctc      1680
     tggtgagcct agggtgaccc tggagagggt caggccaggg tagggacagc agggatggct      1740
     gtggctctct gcccagtgta taacaagtcc cttttttttc agggaaagtg ctggtgcttc      1800
     agagtcattg gcagacattc catgtttctg ctgttgctgc tgctgctgct gctgctattt      1860
     ttgttattat tattttctac gtctgttgtt gtaagaagaa aacatcagct gcagagggtc      1920
     caggtgagaa                                                             1930
//