Dbfetch

ID   AY064404; SV 1; linear; genomic DNA; STD; HUM; 3326 BP.
XX
AC   AY064404;
XX
DT   28-DEC-2001 (Rel. 70, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*0704v allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3326
RA   Bunce M., Cox S., Marsh H.;
RT   "A novel variant of HLA-Cw*0704";
RL   Unpublished.
XX
RN   [2]
RP   1-3326
RA   Bunce M., Cox S., Marsh H.;
RT   ;
RL   Submitted (29-NOV-2001) to the INSDC.
RL   R&D, Dynal Biotech Ltd, 11, Bassendale Road, Croft Business Park,
RL   Bromborough, Wirral CH62 3QL, UK
XX
DR   MD5; e9e38c679e9e2f16afb5c9bea711dfe8.
DR   EPD; EP73198; HS_HLA-C.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3326
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..263
FT                   /gene="HLA-Cw"
FT   mRNA            join(1..336,467..736,987..1262,1850..2125,2250..2369,
FT                   2810..2842,2950..2997,3162..3326)
FT                   /gene="HLA-Cw"
FT                   /product="MHC class I antigen"
FT   exon            1..336
FT                   /gene="HLA-Cw"
FT                   /number=1
FT   CDS             join(264..336,467..736,987..1262,1850..2125,2250..2369,
FT                   2810..2842,2950..2997,3162..3166)
FT                   /codon_start=1
FT                   /gene="HLA-Cw"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q7YQB2"
FT                   /db_xref="IMGT/HLA:C*07:04:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q7YQB2"
FT                   /protein_id="AAL49978.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTFQRMYGCDLGPDGRLLRGYDQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQDRAYLEGTCVEWLRRYLENGKKTLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGG
FT                   KGGSCSQAACSNSAQGSDESLITCKA"
FT   exon            467..736
FT                   /gene="HLA-Cw"
FT                   /number=2
FT   exon            987..1262
FT                   /gene="HLA-Cw"
FT                   /number=3
FT   exon            1850..2125
FT                   /gene="HLA-Cw"
FT                   /number=4
FT   exon            2250..2369
FT                   /gene="HLA-Cw"
FT                   /number=5
FT   exon            2810..2842
FT                   /gene="HLA-Cw"
FT                   /number=6
FT   exon            2950..2997
FT                   /gene="HLA-Cw"
FT                   /number=7
FT   exon            3162..3326
FT                   /gene="HLA-Cw"
FT                   /number=8
FT   3'UTR           3167..3326
FT                   /gene="HLA-Cw"
XX
SQ   Sequence 3326 BP; 616 A; 981 C; 1034 G; 695 T; 0 other;
     aggtcccggg cggggctctc agggtctcag gctccaaggg ccgtgtctgc actggggagg        60
     cgccgcgttg aggattctcc actcccctga gtttcacttc tcccaacctg cgtcgggtcc       120
     ttcttcctga atactcatga cgcgtcccca attcccactc ccattgggtg tcgggttcta       180
     gagaagccaa tcagcgtctc cgcagtcccg gttctaaagt ccccagtcac ccacccggac       240
     tcacattctc cccagaggcc gagatgcggg tcatggcgcc ccgagccctc ctcctgctgc       300
     tctcgggagg cctggccctg accgagacct gggcctgtga gtgcggggtt gggagggaag       360
     cggcctctgc ggagaggagc gaggggccct cccggcgagg gcgcaggacc cggggagccg       420
     cgcagggagg tgggtcgggc gggtctcagc ccctcctcgc ccccaggctc ccactccatg       480
     aggtatttcg acaccgccgt gtcccggccc ggccgcggag agccccgctt catctcagtg       540
     ggctacgtgg acgacacgca gttcgtgcgg ttcgacagcg acgccgcgag tccgagaggg       600
     gagccccggg cgccgtgggt ggagcaggag gggccggagt attgggaccg ggagacacag       660
     aagtacaagc gccaggcaca ggctgaccga gtgagcctgc ggaacctgcg cggctactat       720
     aaccagagcg aggacggtga gtgaccccgg cccggggcgc aggtcacgac ccctccccat       780
     cccccacgga cggcccgggt cgccccgagt ctccccgtct gagatccacc ccaaggtgga       840
     tctgcggaac ccgcccagac cctcgaccgg agagagcccc agtcgccttt acccggtttc       900
     attttcggtt taggccaaaa tccccgcggg ttggtcgggg cggggcgggg ctcgggggac       960
     tgggctgacc gcgggggcgg ggccagggtc tcacaccttc cagaggatgt atggctgcga      1020
     cctggggccc gacgggcgcc tcctccgcgg gtatgaccag ttcgcctacg acggcaagga      1080
     ttacatcgcc ctgaacgagg acctgcgctc ctggaccgcc gcggacaccg cggctcagat      1140
     cacccagcgc aagttggagg cggcccgtgc ggcggagcag gacagagcct acctggaggg      1200
     cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aagaagacgc tgcagcgcgc      1260
     gggtaccagg ggcagtgggg agccttcccc atctcctata gatctcccgg gatggcctcc      1320
     cacgaggagg ggaggaaaat gggatcagca ctggaatatc gccctccctt gaatggagaa      1380
     tggcatgagt tttcctgagt ttcctctgag ggccccctct gctctctagg acaattaagg      1440
     gatgaagtct ctgaggaaat ggaggggaag acagtccctg gaatactgat caggggtctc      1500
     ctttgaccac tttgaccact gcagcagctg tggtcaggct gctgaccttt ctctcaggcc      1560
     ttgttctctg cctcacactc aatgtgtctg aaggtttgac tccagctttt ctgagtcctg      1620
     cagcctccac tcaggtcagg accagaagtc gctgttcctc cctcagagac tagaactttc      1680
     caatgaatag gagattatcc caggtgcctg tgtccaggct ggcgtctggg ttctgtgccg      1740
     ccttccccac cccaggtgtc ctgtccattc tcaggatggt cacatgggcg ctgctggagt      1800
     gtcccaagag agatgcaaag tgtctgaatt ttctgactct tcccgtcaga acccccaaag      1860
     acacacgtga cccaccaccc cctctctgac catgaggcca ccctgaggtg ctgggccctg      1920
     ggcttctacc ctgcggagat cacactgacc tggcagcggg atggggagga ccagacccag      1980
     gacaccgagc ttgtggagac caggccagca ggagatggaa ccttccagaa gtgggcagct      2040
     gtggtggtgc cttctggaca agagcagaga tacacgtgcc atatgcagca cgaggggctg      2100
     caagagcccc tcaccctgag ctggggtaag gaggggaatg gggggtcaca tctcttatca      2160
     gagaaagcag aagtccttct ggagcccttc agccgggtca gggctgaggc ttgggggtca      2220
     gggcccctca ccttctcctc ctttcccaga gccatcttcc cagcccacca tccccatcat      2280
     gggcatcgtt gctggcctgg ctgtcctggt tgtcctagct gtccttggag ctgtggtcac      2340
     cgctatgatg tgtaggagga agagctcagg tagggaaggg gtgaagagcg gggtctgggt      2400
     tttcttgtcc cactgggagt ttcaagcccc aggtagaagt gtgccccgcc ttgttactgg      2460
     aagcaccatc cacacatggg ccatcccagc ctgggaccct gtgtgccagc acttactctt      2520
     ttgtgaagca catgtgacaa tgaaggacgg atgtatcacc ttgatgatta tggtgttggg      2580
     gtcctgattc cagcattcat gagtcagggg aaggtccctg ctaaggacag accttaggag      2640
     ggcagttggt ccagaaccca cagctgcttt ccccatgttt cctgatcctg ccctgggtct      2700
     gcagtcgtag ttctggaaac ttctcttggg tccaagacta ggaggttccc ctaagatcac      2760
     atggccctgc ctcctcccag tcccctcata gggcattttc ttcccacagg tggaaaagga      2820
     gggagctgct ctcaggctgc gtgtaagtga tggcggtggg cgtgtggagg agctcaccta      2880
     ctccataact cctcttgtcc cacatctcct gcgggctctg accaggtctt tttttttgtt      2940
     ctaccccagg cagcaacagt gcccagggct ctgatgagtc tctcatcact tgtaaaggtg      3000
     agattctggg gagctgaagt ggtcgggggt ggggcagagg gaaaaggcct gggtaatggg      3060
     gattctttga ttgggacgtt tcgagtgtgt ggtgggccgt tcagagtgtc atcacttacc      3120
     atgactgacc tgaatttgtt catgactatt gtgttctgta gcctgagaca gctgcctgtg      3180
     tgggactgag atgcaggatt tcttcacacc tctcctttgt gacttcaaga gcctctggca      3240
     tctctttctg caaaggcatc tgaatgtgtc tgcgttcctg ttagcataat gtgaggaggt      3300
     ggagagacag cccacccccg tgtcca                                           3326
//